SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442556388|ref|YP_007366213.1| from Lawsonia intracellularis N343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442556388|ref|YP_007366213.1|
Domain Number 1 Region: 464-566
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000107
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 2 Region: 445-538,580-657,794-853,949-1018
Classification Level Classification E-value
Superfamily TPR-like 0.00000000449
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  gi|442556388|ref|YP_007366213.1|
Domain Number - Region: 701-836
Classification Level Classification E-value
Superfamily TPR-like 0.000228
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|442556388|ref|YP_007366213.1|
Sequence length 1041
Comment tetratricopeptide repeat family protein [Lawsonia intracellularis N343]
Sequence
MLPGRERIIISYDTPNQGKKASRISTTQLEIPLSTPAKDLSRIGASPSPESLVSDLSLDG
SKLHINLRDAAFGYITTSTNPNQLIIDVFSDPLGNRWRNLGVPAPASAPSRASSALPEVP
KNISKQIKVSNNGQRLNKDQEKTSLSQEQKQVAKAPAESITSEGKAEKKQSIKADTSKDN
VKKSQDVKGTLPVDTKDKQQVSKKENQEAISKEEKIETVPTVPPPSVDELTMLTAKVEKS
QLASDEYSWSKKAKSPAQEDNTEEKLEKSQNNNNQKVNILENSSSSTEGTVQSKLTETPI
VEAPIEETVNSIHSKLNFKGPDAWPKEKALSTLDKLEEVLNKNKLMQQPETRDSLQPLSK
TNEEKPVSEPVVVYVDEKGNPVGKPPDTTAIIEEAKKNMRAGQVQKAKDLLATLKGHALV
QEQHEEVLYLFSELNEKIYKDRWIEGYEPIITSTNKAMNFNLRSPRVAEALMRLGMVNLR
IGNQDEAAGYFGALRRKFPQSEFIPEAYLALGKDQFSKGEYADAVKTFQLILDNYPESKA
VQDASRFMAEALFKQGHYSRALILVDFVDRRWPRLYLEDPNYLKMVGDLYSRENRLDDAL
KAYWTYYNLVPEAKDSHDTLFKIGTSYFKKGLMQGGKDVFEELLKKFPKSDSAPKALLAL
GEEQVIKENPTIQELVTIFENPSSTIPEIYYKKILDEYPNSPEAQQAAIRLAAWKLWHRD
IPTAMTMAQQFLDKYPESPYAPRAEEIIARGFDQSFALALQEENYERILSLWEKYPYLQI
AYKDMTDELRVALARAYLNRGDEEKGMDLLNQFLESPQDPNYGDYVYNLYLAHYLRKEDW
TNILKLGEKVSSWKFPVSARAQLDYALAIASENLGLGNKALPLWERLYQREDIPLYQKAY
ANYFMARDAERRRDLNAAYKLNLNTLKLFVTLQEERSDKADPERVRESLAALMDVTEVAN
RFVESLEWADQYAAFVPETSPDYAGLLFRKARLYRKMGDLSKWKQLLDEIVRREPESVFG
RMAASELRTYEVSRDLSRFTQ
Download sequence
Identical sequences gi|442556388|ref|YP_007366213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]