SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345007775|ref|YP_004800320.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|345007775|ref|YP_004800320.1|
Domain Number - Region: 7-110
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0416
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345007775|ref|YP_004800320.1|
Sequence length 129
Comment hypothetical protein Strvi_0061 [Streptomyces violaceusniger Tu 4113]
Sequence
MAGTRTTTPTPTPVQAWSTVAGWVVTVAVFVGWVWLKAPARALWAVKGVRVVAWLFLAPV
AWWLFRTAVRCGWVVLRWLIVPVVAVLWTRVSARPDVRDAVKAMRKGRKRGRKSGKRIAR
QIYGVSAVA
Download sequence
Identical sequences G2PHN6
gi|345007775|ref|YP_004800320.1| gi|345007775|ref|YP_004800320.1|NC_015952 WP_014043772.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]