SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345008057|ref|YP_004810411.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345008057|ref|YP_004810411.1|
Domain Number 1 Region: 180-385
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.52e-43
Family ATP-dependent DNA ligase catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 387-510
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0021
Further Details:      
 
Domain Number 3 Region: 5-202
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 7.32e-27
Family ATP-dependent DNA ligase DNA-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345008057|ref|YP_004810411.1|
Sequence length 512
Comment DNA ligase [Streptomyces violaceusniger Tu 4113]
Sequence
MLLADVALTSRQVAATSARSEKIAALARLFRRTEPAEAAVVITYLAGKLPQRRTGVGWST
LRHRQEPAAEPTLAVLDVDEALTRVAAVSGTGATAARKRLVGELLAAATKEEQGFLLGLI
GGELRQGALEGLAVEGLAQAVGAPAAEVRRAVMVGGSLGTVAEALLARGPEALAGFRLEV
GRPVLPMLAQSAKDLDEAIDRLGPCAVEEKLDGIRVQVHRDGEDVRIYTRTLDEITDRLP
EVVTAARELAVDRAILDGEVILLDGEGRPRPFQETSARVGSRLDVAGASAALPLSPVFFD
LLVVDDRDLLDLPARERHAELARIAPGPRRVRRLVTDDPADPETRRAAREFAADVLARGH
EGVLVKALEAPYGAGRRGASWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARAADG
TYLMLGKTFKGLTDAMLEWQTQALLGIAVSDDGWVVRVRPELVVEVAFDGLQRSSRYPAG
VTLRFARVLRYREDKPADQADTVEAVLALRGE
Download sequence
Identical sequences G2PB79
gi|345008057|ref|YP_004810411.1| WP_014053655.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]