SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345008905|ref|YP_004811259.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345008905|ref|YP_004811259.1|
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.54e-21
Family DNA-binding N-terminal domain of transcription activators 0.0041
Further Details:      
 
Domain Number 2 Region: 117-264
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000000977
Family Multidrug-binding domain of transcription activator BmrR 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345008905|ref|YP_004811259.1|
Sequence length 268
Comment MerR family transcriptional regulator [Streptomyces violaceusniger Tu 4113]
Sequence
MHEELLTIGRFARLCRLSIKQLRHYDETGLLAPVRVDANSGYRYYAPEQARDALTVALLR
EMDLPLAVIAQALAAEPESRAQILRAERDRLAERISRDQARLEMLERLAEGGLPGYEVTM
GSEPERRLAVVRAVCAFEEIGETFGACVGRLLPVLGKEGIAWEPPLWGLYPLDLEERMEI
AVGAQTSQGEGTPGLEFQTLPGGPVAETVHIGPYAQLPLAYNALFAAAHERGLRPQAPVR
EVYLVGPTEAPQEEWTTRLIIPVQESTA
Download sequence
Identical sequences G2PBQ7
WP_014054491.1.85068 gi|345008905|ref|YP_004811259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]