SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345009967|ref|YP_004812321.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345009967|ref|YP_004812321.1|
Domain Number 1 Region: 290-425
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.44e-32
Family Oxidoreductase molybdopterin-binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|345009967|ref|YP_004812321.1|
Domain Number - Region: 67-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00419
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345009967|ref|YP_004812321.1|
Sequence length 430
Comment molybdopterin-binding oxidoreductase [Streptomyces violaceusniger Tu 4113]
Sequence
MSHPPRTHRDRRALWRSPLRGPWLTSVLGLVLLFGLPVLFVTGLLSYAAYNPNLSPVNDQ
TPDKGLLGFYLFTWPTNPSWLYRVNQGVHVTLGIVLVPVLLAKLWSVIPKLFTWPPVRSV
GHGLERLSLLALVGGGLFEFATGVLNVQLDYIFPGSFYPLHFYGAWIFMAALVVHVALRV
PVMVRALRSRDLRAELRTRASDTKPEPPDETGLVSPQPAAPTMSRRGALAMVGTGSFALL
VVTAGQSIGGPLRETAVLAPHGRNPGSGPNGFQINKTAMAVGVRARDIGPDWRLVVRGAT
GRETVLTRERLLRLPRHGAALPIACVEGWSTSDQRWDGVRLADLAALVGHADRPPRVLVE
SVQRHGSFRRVVLSDVQVRDPRSLLALKVNGADLSPDHGYPARVIVPGAPGVHNTKWVGR
LTFGNFEETA
Download sequence
Identical sequences G2NYH4
gi|345009967|ref|YP_004812321.1| WP_014055546.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]