SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345011174|ref|YP_004813528.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|345011174|ref|YP_004813528.1|
Domain Number - Region: 130-196
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00185
Family PriA-like 0.013
Further Details:      
 
Domain Number - Region: 36-98
Classification Level Classification E-value
Superfamily HemD-like 0.0732
Family HemD-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345011174|ref|YP_004813528.1|
Sequence length 334
Comment DNA polymerase LigD, polymerase domain-containing protein [Streptomyces violaceusniger Tu 4113]
Sequence
MAESVELTVGGRTVRVTNPGKVYFPERGFTKLDLARYYLAVGEGALRALRDRPTTLERYP
DGVDGESFFQKRAPKNLPEWIPTGRISFPSGRHADEICPTETAAVVWAANLGSLTFHPWP
VRREDTEHPDELRIDLDPQPGTDYEDAVRAAEELREVLDGLGLRGWPKTSGGRGLHVFVP
IAPEWTFTQVRRSAIAIARELERRAPERVTTKWWKEERGRKIFVDYNQTARDRTIASAYS
VRPRPHAPVSAPLRWAEVPDARPRDFDLATMPVRYRELGDVHADMDEHAFRLESALELAT
RDEQEHGLGDLPYPPEHPKAAGEPKRVQPSRAKK
Download sequence
Identical sequences G2PEB7
gi|345011174|ref|YP_004813528.1| WP_014056746.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]