SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345014029|ref|YP_004816383.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345014029|ref|YP_004816383.1|
Domain Number 1 Region: 47-246
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.45e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345014029|ref|YP_004816383.1|
Sequence length 266
Comment hypothetical protein [Streptomyces violaceusniger Tu 4113]
Sequence
MTSTPGSVNRTDATMTPPPERMTPPSERTMTASSRAGGRDQDHDQDRSRVRRFSLAERWI
HRTTALLLGVCVFSAGCLYLPQLAELVGRRALVVTVHEWSGILTPLPALLGLASRAFRAD
LTRLNRFGPHDRRWLRAALRRDRRRQERPAGKFNAGQKLYAGYIAGAVMVMAGTGLLMWF
TGLAPLVWRTSATFVHDWLALAIGLVLIGHIGKAFADPEARRGMRTGRVERAWAARQHPL
WRPDEDAADGHRDAGRDIGDHERHVR
Download sequence
Identical sequences G2P8A7
gi|345014029|ref|YP_004816383.1| WP_014059580.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]