SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345008758|ref|YP_004811112.1| from Streptomyces violaceusniger Tu 4113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345008758|ref|YP_004811112.1|
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.84e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 214-324
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.37e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0068
Further Details:      
 
Domain Number 3 Region: 101-227
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.94e-26
Family Aromatic dioxygenase reductase-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345008758|ref|YP_004811112.1|
Sequence length 325
Comment ferredoxin [Streptomyces violaceusniger Tu 4113]
Sequence
MNPGGEYEDTLLVARREDVASDVVALTLRHPTGRELPAWEPGAHLDLVLAPGPTRQYSLC
GDPADRASWRIAVLRAPAGRGGSARVHDTLAEGSTVRVRGPRNHFALRPAARYLFIAGGI
GITPLLPMTAAAEAAGADWRLLYGGRTRASMAFADQLTARYGDKVRLVPQDEEGLLDLAP
YLDAPSAPSAPGTLVYCCGPEPLLQAAEQACRGWPDGALHTERFQPRTDAAGAEPARGAF
ELVLTRSGLTLTVEPERSVLRTVEAAGVPVLYSCEEGTCGTCETDVVEGEVDHHDSVLTG
EERASGETMMICVSRCRGPRLVLDL
Download sequence
Identical sequences G2P074
gi|345008758|ref|YP_004811112.1| WP_014054344.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]