SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538360585|ref|YP_008503870.1| from Salmonella enterica serovar Bovismorbificans genomics

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538360585|ref|YP_008503870.1|
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.99e-63
Family Type II chitinase 0.00021
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000058
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000667
Family Carbohydrate binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|538360585|ref|YP_008503870.1|
Sequence length 699
Comment exochitinase [Salmonella enterica subsp. enterica serovar Bovismorbificans str. 3114]
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFRKIDTEDRDVVAEAAAL
CGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAKGLLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQFPMFSEVDIDWEYPNNEGA
GNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDYAKVKDLMAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAPKAAIELMVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAEDDTPADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences A0A0D6HLQ3 A0A0F6AWD8 A0A0F7J4S0 A0A0M0QQN2 A0A0T9X930 A0A0U1IU75 A0A249V431 A0A265BCT1 A0A2D3AKI7 A0A2H9YJI6 E8XG39 Q8ZS09
454169.SeHA_C0020 99287.STM0018 gi|482902566|ref|YP_007901126.1| gi|378698001|ref|YP_005179958.1| gi|383494841|ref|YP_005395530.1| gi|379699236|ref|YP_005240964.1| gi|378982559|ref|YP_005245714.1| NYSGXRC-11091j gi|538360585|ref|YP_008503870.1| gi|16763408|ref|NP_459023.1| gi|525827920|ref|YP_008250649.1| gi|549722746|ref|YP_008642936.1| gi|378443472|ref|YP_005231104.1| gi|378448296|ref|YP_005235655.1| gi|525815875|ref|YP_008245893.1| gi|550899449|ref|YP_008668541.1| gi|525839503|ref|YP_008256808.1| ABAM02000001|CDS_519162-521261 ABAO01000001|CDS_64157-66256 ABEL01000014|CDS_28282-26183 AE006468|CDS_17867-19966 CP001120|CDS_17868-19967 CP001363|CDS_17867-19966 FN424405|CDS_17867-19966 gi|386589902|ref|YP_006086302.1| gi|526218983|ref|YP_008264277.1| NP_459023.1.58477 WP_000235798.1.100002 WP_000235798.1.100010 WP_000235798.1.100234 WP_000235798.1.100258 WP_000235798.1.100376 WP_000235798.1.100424 WP_000235798.1.100436 WP_000235798.1.100472 WP_000235798.1.100484 WP_000235798.1.100488 WP_000235798.1.100597 WP_000235798.1.100730 WP_000235798.1.10076 WP_000235798.1.100781 WP_000235798.1.100793 WP_000235798.1.100869 WP_000235798.1.100870 WP_000235798.1.100871 WP_000235798.1.100882 WP_000235798.1.101020 WP_000235798.1.101074 WP_000235798.1.101078 WP_000235798.1.101180 WP_000235798.1.101259 WP_000235798.1.101284 WP_000235798.1.1013 WP_000235798.1.101320 WP_000235798.1.101353 WP_000235798.1.101386 WP_000235798.1.101404 WP_000235798.1.101420 WP_000235798.1.101589 WP_000235798.1.101707 WP_000235798.1.101953 WP_000235798.1.10220 WP_000235798.1.10231 WP_000235798.1.10266 WP_000235798.1.10439 WP_000235798.1.10566 WP_000235798.1.10678 WP_000235798.1.10753 WP_000235798.1.10992 WP_000235798.1.11000 WP_000235798.1.11031 WP_000235798.1.11098 WP_000235798.1.1110 WP_000235798.1.11156 WP_000235798.1.11168 WP_000235798.1.11190 WP_000235798.1.11295 WP_000235798.1.11458 WP_000235798.1.11518 WP_000235798.1.11532 WP_000235798.1.11543 WP_000235798.1.11588 WP_000235798.1.11677 WP_000235798.1.11687 WP_000235798.1.11735 WP_000235798.1.11763 WP_000235798.1.11834 WP_000235798.1.11897 WP_000235798.1.12017 WP_000235798.1.12025 WP_000235798.1.12114 WP_000235798.1.12280 WP_000235798.1.12351 WP_000235798.1.12370 WP_000235798.1.12546 WP_000235798.1.1264 WP_000235798.1.12728 WP_000235798.1.12879 WP_000235798.1.12936 WP_000235798.1.12995 WP_000235798.1.13027 WP_000235798.1.13106 WP_000235798.1.13130 WP_000235798.1.13207 WP_000235798.1.13414 WP_000235798.1.13488 WP_000235798.1.13509 WP_000235798.1.13661 WP_000235798.1.1387 WP_000235798.1.13908 WP_000235798.1.13932 WP_000235798.1.13968 WP_000235798.1.14001 WP_000235798.1.14041 WP_000235798.1.14111 WP_000235798.1.14151 WP_000235798.1.14212 WP_000235798.1.14239 WP_000235798.1.14286 WP_000235798.1.14320 WP_000235798.1.14379 WP_000235798.1.14406 WP_000235798.1.14410 WP_000235798.1.14436 WP_000235798.1.14458 WP_000235798.1.14466 WP_000235798.1.14524 WP_000235798.1.14554 WP_000235798.1.14618 WP_000235798.1.14725 WP_000235798.1.14808 WP_000235798.1.14852 WP_000235798.1.1489 WP_000235798.1.14932 WP_000235798.1.15046 WP_000235798.1.15055 WP_000235798.1.15124 WP_000235798.1.15226 WP_000235798.1.15316 WP_000235798.1.15369 WP_000235798.1.1540 WP_000235798.1.15508 WP_000235798.1.1551 WP_000235798.1.15784 WP_000235798.1.15830 WP_000235798.1.15862 WP_000235798.1.15910 WP_000235798.1.15986 WP_000235798.1.16004 WP_000235798.1.16006 WP_000235798.1.16047 WP_000235798.1.16062 WP_000235798.1.16063 WP_000235798.1.16103 WP_000235798.1.16226 WP_000235798.1.16233 WP_000235798.1.16284 WP_000235798.1.16328 WP_000235798.1.1635 WP_000235798.1.16361 WP_000235798.1.16468 WP_000235798.1.16525 WP_000235798.1.16614 WP_000235798.1.16650 WP_000235798.1.16686 WP_000235798.1.16691 WP_000235798.1.167 WP_000235798.1.16732 WP_000235798.1.16735 WP_000235798.1.16786 WP_000235798.1.16858 WP_000235798.1.16873 WP_000235798.1.1689 WP_000235798.1.16896 WP_000235798.1.16903 WP_000235798.1.16965 WP_000235798.1.1700 WP_000235798.1.17093 WP_000235798.1.17307 WP_000235798.1.17390 WP_000235798.1.174 WP_000235798.1.17480 WP_000235798.1.17546 WP_000235798.1.17702 WP_000235798.1.17705 WP_000235798.1.17743 WP_000235798.1.17747 WP_000235798.1.17755 WP_000235798.1.17891 WP_000235798.1.1798 WP_000235798.1.18019 WP_000235798.1.18111 WP_000235798.1.18122 WP_000235798.1.18163 WP_000235798.1.1818 WP_000235798.1.18254 WP_000235798.1.18265 WP_000235798.1.18267 WP_000235798.1.18282 WP_000235798.1.18607 WP_000235798.1.18705 WP_000235798.1.18715 WP_000235798.1.18776 WP_000235798.1.18822 WP_000235798.1.18881 WP_000235798.1.18949 WP_000235798.1.19053 WP_000235798.1.19240 WP_000235798.1.19273 WP_000235798.1.19320 WP_000235798.1.19458 WP_000235798.1.19460 WP_000235798.1.19461 WP_000235798.1.19588 WP_000235798.1.19614 WP_000235798.1.19616 WP_000235798.1.19642 WP_000235798.1.19660 WP_000235798.1.19702 WP_000235798.1.19706 WP_000235798.1.19724 WP_000235798.1.19749 WP_000235798.1.19784 WP_000235798.1.19793 WP_000235798.1.19802 WP_000235798.1.19809 WP_000235798.1.19867 WP_000235798.1.19975 WP_000235798.1.20 WP_000235798.1.20034 WP_000235798.1.2010 WP_000235798.1.20119 WP_000235798.1.20266 WP_000235798.1.20271 WP_000235798.1.20330 WP_000235798.1.20362 WP_000235798.1.20376 WP_000235798.1.20418 WP_000235798.1.20443 WP_000235798.1.20446 WP_000235798.1.20525 WP_000235798.1.2054 WP_000235798.1.20553 WP_000235798.1.20614 WP_000235798.1.20626 WP_000235798.1.20646 WP_000235798.1.20908 WP_000235798.1.21049 WP_000235798.1.21136 WP_000235798.1.21146 WP_000235798.1.21245 WP_000235798.1.21246 WP_000235798.1.21269 WP_000235798.1.21351 WP_000235798.1.21400 WP_000235798.1.21404 WP_000235798.1.21497 WP_000235798.1.21499 WP_000235798.1.21548 WP_000235798.1.21603 WP_000235798.1.21751 WP_000235798.1.21757 WP_000235798.1.21991 WP_000235798.1.22024 WP_000235798.1.2205 WP_000235798.1.22062 WP_000235798.1.22067 WP_000235798.1.2221 WP_000235798.1.22235 WP_000235798.1.2224 WP_000235798.1.2235 WP_000235798.1.22379 WP_000235798.1.2246 WP_000235798.1.22485 WP_000235798.1.22537 WP_000235798.1.22620 WP_000235798.1.22692 WP_000235798.1.22758 WP_000235798.1.22864 WP_000235798.1.22979 WP_000235798.1.23102 WP_000235798.1.23114 WP_000235798.1.2314 WP_000235798.1.23192 WP_000235798.1.23259 WP_000235798.1.23379 WP_000235798.1.23460 WP_000235798.1.23466 WP_000235798.1.23472 WP_000235798.1.23482 WP_000235798.1.23509 WP_000235798.1.23634 WP_000235798.1.2364 WP_000235798.1.23932 WP_000235798.1.23959 WP_000235798.1.24082 WP_000235798.1.24206 WP_000235798.1.24308 WP_000235798.1.24325 WP_000235798.1.24578 WP_000235798.1.24737 WP_000235798.1.24779 WP_000235798.1.25008 WP_000235798.1.25036 WP_000235798.1.25119 WP_000235798.1.25206 WP_000235798.1.25405 WP_000235798.1.25454 WP_000235798.1.25493 WP_000235798.1.25668 WP_000235798.1.25690 WP_000235798.1.2570 WP_000235798.1.25740 WP_000235798.1.25793 WP_000235798.1.25814 WP_000235798.1.25988 WP_000235798.1.26311 WP_000235798.1.26319 WP_000235798.1.26429 WP_000235798.1.26440 WP_000235798.1.26493 WP_000235798.1.26551 WP_000235798.1.26567 WP_000235798.1.2660 WP_000235798.1.26741 WP_000235798.1.26856 WP_000235798.1.26919 WP_000235798.1.27010 WP_000235798.1.27084 WP_000235798.1.27173 WP_000235798.1.27206 WP_000235798.1.27223 WP_000235798.1.27279 WP_000235798.1.27423 WP_000235798.1.27544 WP_000235798.1.27556 WP_000235798.1.27561 WP_000235798.1.2763 WP_000235798.1.27665 WP_000235798.1.27755 WP_000235798.1.27761 WP_000235798.1.27857 WP_000235798.1.27977 WP_000235798.1.28032 WP_000235798.1.28094 WP_000235798.1.28126 WP_000235798.1.28170 WP_000235798.1.28302 WP_000235798.1.2835 WP_000235798.1.28370 WP_000235798.1.28538 WP_000235798.1.28575 WP_000235798.1.28625 WP_000235798.1.28655 WP_000235798.1.28694 WP_000235798.1.28776 WP_000235798.1.2879 WP_000235798.1.2890 WP_000235798.1.28938 WP_000235798.1.28946 WP_000235798.1.29006 WP_000235798.1.29010 WP_000235798.1.2910 WP_000235798.1.29113 WP_000235798.1.29130 WP_000235798.1.29509 WP_000235798.1.29588 WP_000235798.1.29606 WP_000235798.1.29615 WP_000235798.1.29619 WP_000235798.1.29704 WP_000235798.1.29827 WP_000235798.1.29969 WP_000235798.1.29990 WP_000235798.1.30006 WP_000235798.1.30022 WP_000235798.1.30027 WP_000235798.1.30180 WP_000235798.1.30202 WP_000235798.1.30469 WP_000235798.1.30507 WP_000235798.1.30535 WP_000235798.1.30547 WP_000235798.1.30573 WP_000235798.1.30794 WP_000235798.1.30833 WP_000235798.1.30835 WP_000235798.1.30972 WP_000235798.1.31 WP_000235798.1.31092 WP_000235798.1.31107 WP_000235798.1.31122 WP_000235798.1.3113 WP_000235798.1.31185 WP_000235798.1.3119 WP_000235798.1.31190 WP_000235798.1.31195 WP_000235798.1.31196 WP_000235798.1.31219 WP_000235798.1.31251 WP_000235798.1.3127 WP_000235798.1.31281 WP_000235798.1.31362 WP_000235798.1.31451 WP_000235798.1.31504 WP_000235798.1.31515 WP_000235798.1.31578 WP_000235798.1.31658 WP_000235798.1.31940 WP_000235798.1.31967 WP_000235798.1.31972 WP_000235798.1.32192 WP_000235798.1.32206 WP_000235798.1.32260 WP_000235798.1.32277 WP_000235798.1.32438 WP_000235798.1.32515 WP_000235798.1.32527 WP_000235798.1.32629 WP_000235798.1.32660 WP_000235798.1.32714 WP_000235798.1.32747 WP_000235798.1.32786 WP_000235798.1.32804 WP_000235798.1.32860 WP_000235798.1.32907 WP_000235798.1.33030 WP_000235798.1.33078 WP_000235798.1.33127 WP_000235798.1.33143 WP_000235798.1.33248 WP_000235798.1.33261 WP_000235798.1.333 WP_000235798.1.33492 WP_000235798.1.33553 WP_000235798.1.33580 WP_000235798.1.33592 WP_000235798.1.33609 WP_000235798.1.33825 WP_000235798.1.33894 WP_000235798.1.3394 WP_000235798.1.34043 WP_000235798.1.34075 WP_000235798.1.34257 WP_000235798.1.34279 WP_000235798.1.34319 WP_000235798.1.34417 WP_000235798.1.34453 WP_000235798.1.34496 WP_000235798.1.34610 WP_000235798.1.3476 WP_000235798.1.34856 WP_000235798.1.34975 WP_000235798.1.34977 WP_000235798.1.35045 WP_000235798.1.35129 WP_000235798.1.35184 WP_000235798.1.35193 WP_000235798.1.35404 WP_000235798.1.35408 WP_000235798.1.35425 WP_000235798.1.35429 WP_000235798.1.35446 WP_000235798.1.35463 WP_000235798.1.35503 WP_000235798.1.35509 WP_000235798.1.35590 WP_000235798.1.35892 WP_000235798.1.35940 WP_000235798.1.36003 WP_000235798.1.3601 WP_000235798.1.36017 WP_000235798.1.36547 WP_000235798.1.36609 WP_000235798.1.36690 WP_000235798.1.3670 WP_000235798.1.36705 WP_000235798.1.36918 WP_000235798.1.36931 WP_000235798.1.37063 WP_000235798.1.37073 WP_000235798.1.37111 WP_000235798.1.37112 WP_000235798.1.37293 WP_000235798.1.37376 WP_000235798.1.3744 WP_000235798.1.37498 WP_000235798.1.37618 WP_000235798.1.37687 WP_000235798.1.37968 WP_000235798.1.37978 WP_000235798.1.38125 WP_000235798.1.38145 WP_000235798.1.38273 WP_000235798.1.383 WP_000235798.1.3848 WP_000235798.1.38569 WP_000235798.1.38613 WP_000235798.1.38673 WP_000235798.1.3869 WP_000235798.1.38693 WP_000235798.1.38773 WP_000235798.1.38781 WP_000235798.1.38882 WP_000235798.1.38913 WP_000235798.1.39003 WP_000235798.1.39136 WP_000235798.1.39197 WP_000235798.1.39229 WP_000235798.1.39265 WP_000235798.1.39385 WP_000235798.1.39405 WP_000235798.1.39420 WP_000235798.1.39449 WP_000235798.1.39497 WP_000235798.1.39512 WP_000235798.1.39556 WP_000235798.1.39584 WP_000235798.1.39629 WP_000235798.1.39724 WP_000235798.1.39763 WP_000235798.1.39862 WP_000235798.1.39921 WP_000235798.1.39923 WP_000235798.1.40017 WP_000235798.1.40072 WP_000235798.1.40073 WP_000235798.1.4011 WP_000235798.1.40111 WP_000235798.1.40208 WP_000235798.1.40240 WP_000235798.1.40257 WP_000235798.1.40292 WP_000235798.1.40305 WP_000235798.1.40311 WP_000235798.1.40341 WP_000235798.1.40380 WP_000235798.1.40395 WP_000235798.1.40465 WP_000235798.1.40508 WP_000235798.1.40710 WP_000235798.1.4087 WP_000235798.1.40877 WP_000235798.1.40996 WP_000235798.1.41017 WP_000235798.1.41018 WP_000235798.1.41086 WP_000235798.1.41091 WP_000235798.1.41226 WP_000235798.1.41279 WP_000235798.1.41310 WP_000235798.1.41440 WP_000235798.1.41516 WP_000235798.1.41554 WP_000235798.1.41572 WP_000235798.1.41591 WP_000235798.1.41662 WP_000235798.1.41708 WP_000235798.1.41761 WP_000235798.1.4178 WP_000235798.1.41859 WP_000235798.1.41882 WP_000235798.1.41979 WP_000235798.1.41985 WP_000235798.1.41998 WP_000235798.1.42009 WP_000235798.1.42104 WP_000235798.1.42156 WP_000235798.1.4222 WP_000235798.1.42243 WP_000235798.1.42320 WP_000235798.1.42342 WP_000235798.1.42422 WP_000235798.1.42444 WP_000235798.1.42676 WP_000235798.1.4276 WP_000235798.1.42864 WP_000235798.1.4288 WP_000235798.1.43018 WP_000235798.1.43041 WP_000235798.1.43077 WP_000235798.1.43312 WP_000235798.1.43334 WP_000235798.1.43339 WP_000235798.1.43351 WP_000235798.1.43371 WP_000235798.1.43437 WP_000235798.1.43613 WP_000235798.1.43668 WP_000235798.1.43778 WP_000235798.1.43886 WP_000235798.1.43951 WP_000235798.1.44043 WP_000235798.1.44099 WP_000235798.1.44121 WP_000235798.1.44291 WP_000235798.1.44300 WP_000235798.1.44310 WP_000235798.1.44386 WP_000235798.1.44433 WP_000235798.1.44479 WP_000235798.1.44578 WP_000235798.1.44607 WP_000235798.1.44640 WP_000235798.1.4467 WP_000235798.1.44747 WP_000235798.1.4485 WP_000235798.1.44877 WP_000235798.1.44927 WP_000235798.1.44933 WP_000235798.1.44971 WP_000235798.1.45067 WP_000235798.1.45074 WP_000235798.1.45079 WP_000235798.1.45098 WP_000235798.1.45145 WP_000235798.1.45177 WP_000235798.1.45184 WP_000235798.1.45259 WP_000235798.1.45344 WP_000235798.1.45349 WP_000235798.1.45365 WP_000235798.1.45434 WP_000235798.1.45522 WP_000235798.1.45550 WP_000235798.1.45582 WP_000235798.1.45585 WP_000235798.1.45622 WP_000235798.1.45660 WP_000235798.1.45690 WP_000235798.1.45797 WP_000235798.1.458 WP_000235798.1.45848 WP_000235798.1.46011 WP_000235798.1.46028 WP_000235798.1.46069 WP_000235798.1.46112 WP_000235798.1.46174 WP_000235798.1.46187 WP_000235798.1.46278 WP_000235798.1.46286 WP_000235798.1.46303 WP_000235798.1.46434 WP_000235798.1.46574 WP_000235798.1.46595 WP_000235798.1.46620 WP_000235798.1.46675 WP_000235798.1.46693 WP_000235798.1.46749 WP_000235798.1.46930 WP_000235798.1.47008 WP_000235798.1.47057 WP_000235798.1.47067 WP_000235798.1.47214 WP_000235798.1.47429 WP_000235798.1.47448 WP_000235798.1.4747 WP_000235798.1.47472 WP_000235798.1.47478 WP_000235798.1.47579 WP_000235798.1.47621 WP_000235798.1.47799 WP_000235798.1.47814 WP_000235798.1.47992 WP_000235798.1.48242 WP_000235798.1.48253 WP_000235798.1.483 WP_000235798.1.48367 WP_000235798.1.48377 WP_000235798.1.4853 WP_000235798.1.48755 WP_000235798.1.48788 WP_000235798.1.4885 WP_000235798.1.48886 WP_000235798.1.48894 WP_000235798.1.48919 WP_000235798.1.49084 WP_000235798.1.49113 WP_000235798.1.49155 WP_000235798.1.49175 WP_000235798.1.49204 WP_000235798.1.49239 WP_000235798.1.49256 WP_000235798.1.49290 WP_000235798.1.49304 WP_000235798.1.49340 WP_000235798.1.49366 WP_000235798.1.49490 WP_000235798.1.49515 WP_000235798.1.49572 WP_000235798.1.49686 WP_000235798.1.4979 WP_000235798.1.49803 WP_000235798.1.49805 WP_000235798.1.49827 WP_000235798.1.49929 WP_000235798.1.50080 WP_000235798.1.50161 WP_000235798.1.50211 WP_000235798.1.50374 WP_000235798.1.50376 WP_000235798.1.50389 WP_000235798.1.50404 WP_000235798.1.50469 WP_000235798.1.50563 WP_000235798.1.50676 WP_000235798.1.50774 WP_000235798.1.50804 WP_000235798.1.50808 WP_000235798.1.5088 WP_000235798.1.50908 WP_000235798.1.50941 WP_000235798.1.50999 WP_000235798.1.51014 WP_000235798.1.51022 WP_000235798.1.51066 WP_000235798.1.51179 WP_000235798.1.51182 WP_000235798.1.51186 WP_000235798.1.51224 WP_000235798.1.51487 WP_000235798.1.51634 WP_000235798.1.51649 WP_000235798.1.51686 WP_000235798.1.51700 WP_000235798.1.51756 WP_000235798.1.51831 WP_000235798.1.51888 WP_000235798.1.51911 WP_000235798.1.51932 WP_000235798.1.51989 WP_000235798.1.52121 WP_000235798.1.52148 WP_000235798.1.5216 WP_000235798.1.52170 WP_000235798.1.52336 WP_000235798.1.52346 WP_000235798.1.52353 WP_000235798.1.52653 WP_000235798.1.52656 WP_000235798.1.52692 WP_000235798.1.52743 WP_000235798.1.52857 WP_000235798.1.52866 WP_000235798.1.52898 WP_000235798.1.52949 WP_000235798.1.52985 WP_000235798.1.53190 WP_000235798.1.53272 WP_000235798.1.53406 WP_000235798.1.53436 WP_000235798.1.53454 WP_000235798.1.53466 WP_000235798.1.53529 WP_000235798.1.53543 WP_000235798.1.53757 WP_000235798.1.53812 WP_000235798.1.53905 WP_000235798.1.54033 WP_000235798.1.54075 WP_000235798.1.54196 WP_000235798.1.542 WP_000235798.1.54209 WP_000235798.1.54271 WP_000235798.1.54273 WP_000235798.1.54319 WP_000235798.1.54364 WP_000235798.1.54400 WP_000235798.1.54526 WP_000235798.1.54569 WP_000235798.1.54644 WP_000235798.1.54662 WP_000235798.1.54722 WP_000235798.1.54749 WP_000235798.1.54764 WP_000235798.1.55008 WP_000235798.1.55152 WP_000235798.1.55156 WP_000235798.1.5523 WP_000235798.1.55285 WP_000235798.1.55325 WP_000235798.1.55430 WP_000235798.1.55475 WP_000235798.1.5555 WP_000235798.1.5560 WP_000235798.1.55647 WP_000235798.1.55706 WP_000235798.1.55743 WP_000235798.1.55768 WP_000235798.1.55782 WP_000235798.1.55796 WP_000235798.1.55973 WP_000235798.1.55993 WP_000235798.1.56002 WP_000235798.1.56012 WP_000235798.1.56105 WP_000235798.1.56238 WP_000235798.1.56244 WP_000235798.1.56304 WP_000235798.1.56305 WP_000235798.1.56414 WP_000235798.1.56438 WP_000235798.1.56559 WP_000235798.1.56560 WP_000235798.1.56597 WP_000235798.1.56601 WP_000235798.1.56614 WP_000235798.1.56660 WP_000235798.1.56671 WP_000235798.1.56682 WP_000235798.1.56853 WP_000235798.1.56875 WP_000235798.1.56877 WP_000235798.1.57125 WP_000235798.1.57168 WP_000235798.1.57232 WP_000235798.1.57356 WP_000235798.1.57377 WP_000235798.1.57433 WP_000235798.1.57515 WP_000235798.1.57529 WP_000235798.1.57576 WP_000235798.1.57601 WP_000235798.1.57607 WP_000235798.1.57735 WP_000235798.1.5774 WP_000235798.1.57763 WP_000235798.1.57862 WP_000235798.1.57890 WP_000235798.1.57891 WP_000235798.1.5801 WP_000235798.1.58041 WP_000235798.1.58358 WP_000235798.1.58407 WP_000235798.1.58418 WP_000235798.1.58442 WP_000235798.1.58548 WP_000235798.1.5858 WP_000235798.1.58662 WP_000235798.1.58669 WP_000235798.1.58745 WP_000235798.1.58803 WP_000235798.1.58836 WP_000235798.1.5886 WP_000235798.1.58861 WP_000235798.1.59094 WP_000235798.1.59125 WP_000235798.1.59224 WP_000235798.1.59321 WP_000235798.1.59375 WP_000235798.1.59381 WP_000235798.1.59420 WP_000235798.1.59458 WP_000235798.1.59490 WP_000235798.1.59508 WP_000235798.1.5953 WP_000235798.1.59684 WP_000235798.1.59694 WP_000235798.1.59771 WP_000235798.1.5979 WP_000235798.1.59953 WP_000235798.1.60008 WP_000235798.1.60021 WP_000235798.1.60069 WP_000235798.1.60140 WP_000235798.1.60155 WP_000235798.1.60285 WP_000235798.1.60379 WP_000235798.1.60464 WP_000235798.1.60545 WP_000235798.1.60561 WP_000235798.1.60643 WP_000235798.1.60772 WP_000235798.1.60794 WP_000235798.1.60874 WP_000235798.1.60941 WP_000235798.1.6114 WP_000235798.1.6129 WP_000235798.1.61296 WP_000235798.1.61345 WP_000235798.1.61417 WP_000235798.1.61574 WP_000235798.1.61609 WP_000235798.1.61712 WP_000235798.1.61714 WP_000235798.1.61730 WP_000235798.1.61857 WP_000235798.1.61918 WP_000235798.1.61952 WP_000235798.1.62007 WP_000235798.1.62020 WP_000235798.1.62025 WP_000235798.1.6209 WP_000235798.1.62257 WP_000235798.1.62304 WP_000235798.1.62364 WP_000235798.1.62374 WP_000235798.1.62403 WP_000235798.1.62486 WP_000235798.1.6253 WP_000235798.1.62570 WP_000235798.1.62903 WP_000235798.1.62910 WP_000235798.1.62955 WP_000235798.1.63063 WP_000235798.1.63150 WP_000235798.1.63181 WP_000235798.1.63203 WP_000235798.1.63290 WP_000235798.1.63382 WP_000235798.1.63432 WP_000235798.1.63479 WP_000235798.1.63568 WP_000235798.1.63577 WP_000235798.1.63664 WP_000235798.1.63718 WP_000235798.1.6375 WP_000235798.1.63757 WP_000235798.1.63766 WP_000235798.1.63797 WP_000235798.1.63834 WP_000235798.1.63934 WP_000235798.1.64018 WP_000235798.1.64046 WP_000235798.1.6423 WP_000235798.1.64387 WP_000235798.1.64403 WP_000235798.1.64649 WP_000235798.1.64667 WP_000235798.1.64702 WP_000235798.1.64757 WP_000235798.1.64781 WP_000235798.1.64831 WP_000235798.1.64894 WP_000235798.1.64977 WP_000235798.1.65016 WP_000235798.1.65018 WP_000235798.1.65027 WP_000235798.1.65028 WP_000235798.1.65171 WP_000235798.1.65248 WP_000235798.1.65269 WP_000235798.1.6535 WP_000235798.1.65474 WP_000235798.1.65572 WP_000235798.1.65633 WP_000235798.1.6565 WP_000235798.1.65696 WP_000235798.1.65782 WP_000235798.1.6594 WP_000235798.1.65940 WP_000235798.1.65956 WP_000235798.1.66049 WP_000235798.1.6630 WP_000235798.1.66314 WP_000235798.1.66330 WP_000235798.1.66358 WP_000235798.1.66362 WP_000235798.1.6638 WP_000235798.1.66600 WP_000235798.1.66678 WP_000235798.1.66698 WP_000235798.1.66807 WP_000235798.1.66820 WP_000235798.1.66834 WP_000235798.1.66962 WP_000235798.1.67037 WP_000235798.1.67045 WP_000235798.1.67100 WP_000235798.1.67181 WP_000235798.1.67235 WP_000235798.1.67288 WP_000235798.1.6739 WP_000235798.1.67465 WP_000235798.1.67552 WP_000235798.1.67682 WP_000235798.1.67829 WP_000235798.1.67887 WP_000235798.1.67905 WP_000235798.1.68073 WP_000235798.1.68201 WP_000235798.1.68206 WP_000235798.1.6827 WP_000235798.1.68275 WP_000235798.1.68401 WP_000235798.1.68477 WP_000235798.1.6849 WP_000235798.1.68547 WP_000235798.1.68589 WP_000235798.1.68591 WP_000235798.1.68655 WP_000235798.1.68656 WP_000235798.1.6875 WP_000235798.1.68778 WP_000235798.1.68787 WP_000235798.1.68894 WP_000235798.1.68928 WP_000235798.1.68975 WP_000235798.1.69001 WP_000235798.1.69006 WP_000235798.1.6904 WP_000235798.1.6913 WP_000235798.1.69146 WP_000235798.1.69151 WP_000235798.1.69255 WP_000235798.1.69359 WP_000235798.1.69371 WP_000235798.1.6954 WP_000235798.1.69564 WP_000235798.1.69644 WP_000235798.1.69704 WP_000235798.1.69758 WP_000235798.1.7016 WP_000235798.1.7021 WP_000235798.1.70241 WP_000235798.1.70248 WP_000235798.1.70269 WP_000235798.1.70289 WP_000235798.1.70447 WP_000235798.1.70643 WP_000235798.1.70683 WP_000235798.1.70922 WP_000235798.1.70948 WP_000235798.1.70959 WP_000235798.1.71023 WP_000235798.1.7110 WP_000235798.1.71116 WP_000235798.1.71146 WP_000235798.1.71165 WP_000235798.1.71188 WP_000235798.1.71202 WP_000235798.1.71243 WP_000235798.1.71306 WP_000235798.1.71337 WP_000235798.1.71363 WP_000235798.1.71368 WP_000235798.1.71401 WP_000235798.1.71407 WP_000235798.1.71481 WP_000235798.1.71636 WP_000235798.1.71691 WP_000235798.1.71702 WP_000235798.1.71750 WP_000235798.1.71756 WP_000235798.1.71798 WP_000235798.1.71845 WP_000235798.1.71881 WP_000235798.1.71908 WP_000235798.1.71952 WP_000235798.1.71973 WP_000235798.1.72105 WP_000235798.1.72203 WP_000235798.1.72372 WP_000235798.1.72376 WP_000235798.1.72403 WP_000235798.1.72594 WP_000235798.1.72689 WP_000235798.1.72728 WP_000235798.1.72871 WP_000235798.1.72872 WP_000235798.1.72975 WP_000235798.1.73062 WP_000235798.1.73125 WP_000235798.1.7315 WP_000235798.1.73164 WP_000235798.1.73200 WP_000235798.1.7334 WP_000235798.1.73377 WP_000235798.1.73461 WP_000235798.1.73481 WP_000235798.1.7356 WP_000235798.1.73561 WP_000235798.1.73581 WP_000235798.1.73617 WP_000235798.1.73667 WP_000235798.1.73669 WP_000235798.1.73753 WP_000235798.1.73758 WP_000235798.1.73794 WP_000235798.1.73847 WP_000235798.1.7387 WP_000235798.1.73924 WP_000235798.1.73926 WP_000235798.1.7394 WP_000235798.1.73956 WP_000235798.1.74029 WP_000235798.1.74181 WP_000235798.1.74191 WP_000235798.1.7433 WP_000235798.1.74379 WP_000235798.1.74410 WP_000235798.1.745 WP_000235798.1.74529 WP_000235798.1.74545 WP_000235798.1.74644 WP_000235798.1.74745 WP_000235798.1.7491 WP_000235798.1.75129 WP_000235798.1.75187 WP_000235798.1.75288 WP_000235798.1.75334 WP_000235798.1.75362 WP_000235798.1.75385 WP_000235798.1.75392 WP_000235798.1.75402 WP_000235798.1.75760 WP_000235798.1.75764 WP_000235798.1.75828 WP_000235798.1.75837 WP_000235798.1.75874 WP_000235798.1.75884 WP_000235798.1.75945 WP_000235798.1.76020 WP_000235798.1.76024 WP_000235798.1.76252 WP_000235798.1.76327 WP_000235798.1.76445 WP_000235798.1.7660 WP_000235798.1.76673 WP_000235798.1.76706 WP_000235798.1.76721 WP_000235798.1.76756 WP_000235798.1.76760 WP_000235798.1.76875 WP_000235798.1.76880 WP_000235798.1.76899 WP_000235798.1.77038 WP_000235798.1.77047 WP_000235798.1.77080 WP_000235798.1.7712 WP_000235798.1.77177 WP_000235798.1.77180 WP_000235798.1.77244 WP_000235798.1.77267 WP_000235798.1.77292 WP_000235798.1.77349 WP_000235798.1.77514 WP_000235798.1.77529 WP_000235798.1.77549 WP_000235798.1.77692 WP_000235798.1.77710 WP_000235798.1.77729 WP_000235798.1.7782 WP_000235798.1.77846 WP_000235798.1.77851 WP_000235798.1.77898 WP_000235798.1.77918 WP_000235798.1.77960 WP_000235798.1.78033 WP_000235798.1.78076 WP_000235798.1.78096 WP_000235798.1.78100 WP_000235798.1.78110 WP_000235798.1.78120 WP_000235798.1.78372 WP_000235798.1.78383 WP_000235798.1.78407 WP_000235798.1.7861 WP_000235798.1.78618 WP_000235798.1.78673 WP_000235798.1.78735 WP_000235798.1.78802 WP_000235798.1.78830 WP_000235798.1.78835 WP_000235798.1.78838 WP_000235798.1.78874 WP_000235798.1.78918 WP_000235798.1.78930 WP_000235798.1.79167 WP_000235798.1.79335 WP_000235798.1.79462 WP_000235798.1.79472 WP_000235798.1.79490 WP_000235798.1.79495 WP_000235798.1.79529 WP_000235798.1.79570 WP_000235798.1.7964 WP_000235798.1.79642 WP_000235798.1.79659 WP_000235798.1.79668 WP_000235798.1.79708 WP_000235798.1.79734 WP_000235798.1.79845 WP_000235798.1.80077 WP_000235798.1.80137 WP_000235798.1.80182 WP_000235798.1.80236 WP_000235798.1.80250 WP_000235798.1.80296 WP_000235798.1.80366 WP_000235798.1.80586 WP_000235798.1.80741 WP_000235798.1.80831 WP_000235798.1.80850 WP_000235798.1.80881 WP_000235798.1.80939 WP_000235798.1.8096 WP_000235798.1.81037 WP_000235798.1.81069 WP_000235798.1.81149 WP_000235798.1.81175 WP_000235798.1.8119 WP_000235798.1.81193 WP_000235798.1.81305 WP_000235798.1.81320 WP_000235798.1.81328 WP_000235798.1.81354 WP_000235798.1.81410 WP_000235798.1.81425 WP_000235798.1.81528 WP_000235798.1.81735 WP_000235798.1.81750 WP_000235798.1.81760 WP_000235798.1.81785 WP_000235798.1.81902 WP_000235798.1.81974 WP_000235798.1.82192 WP_000235798.1.82232 WP_000235798.1.82337 WP_000235798.1.82464 WP_000235798.1.82503 WP_000235798.1.82515 WP_000235798.1.82676 WP_000235798.1.82761 WP_000235798.1.8282 WP_000235798.1.82944 WP_000235798.1.82956 WP_000235798.1.83092 WP_000235798.1.83163 WP_000235798.1.83365 WP_000235798.1.83413 WP_000235798.1.83491 WP_000235798.1.83523 WP_000235798.1.8354 WP_000235798.1.83651 WP_000235798.1.83721 WP_000235798.1.83760 WP_000235798.1.83979 WP_000235798.1.83995 WP_000235798.1.84103 WP_000235798.1.84283 WP_000235798.1.84291 WP_000235798.1.84397 WP_000235798.1.8441 WP_000235798.1.84532 WP_000235798.1.84554 WP_000235798.1.84659 WP_000235798.1.84693 WP_000235798.1.84899 WP_000235798.1.8497 WP_000235798.1.85040 WP_000235798.1.85134 WP_000235798.1.85178 WP_000235798.1.85180 WP_000235798.1.8533 WP_000235798.1.8545 WP_000235798.1.85469 WP_000235798.1.85481 WP_000235798.1.85483 WP_000235798.1.8556 WP_000235798.1.85568 WP_000235798.1.85615 WP_000235798.1.85617 WP_000235798.1.85663 WP_000235798.1.85671 WP_000235798.1.85672 WP_000235798.1.85777 WP_000235798.1.85855 WP_000235798.1.85886 WP_000235798.1.85900 WP_000235798.1.85904 WP_000235798.1.86043 WP_000235798.1.86173 WP_000235798.1.86306 WP_000235798.1.86310 WP_000235798.1.86356 WP_000235798.1.86450 WP_000235798.1.86453 WP_000235798.1.86469 WP_000235798.1.86580 WP_000235798.1.86588 WP_000235798.1.86661 WP_000235798.1.8671 WP_000235798.1.8672 WP_000235798.1.8678 WP_000235798.1.8684 WP_000235798.1.86895 WP_000235798.1.87095 WP_000235798.1.87219 WP_000235798.1.87323 WP_000235798.1.8736 WP_000235798.1.87460 WP_000235798.1.87552 WP_000235798.1.87695 WP_000235798.1.87779 WP_000235798.1.87899 WP_000235798.1.8792 WP_000235798.1.87945 WP_000235798.1.88014 WP_000235798.1.88019 WP_000235798.1.88073 WP_000235798.1.8809 WP_000235798.1.88092 WP_000235798.1.88291 WP_000235798.1.88293 WP_000235798.1.88303 WP_000235798.1.8837 WP_000235798.1.88393 WP_000235798.1.88703 WP_000235798.1.88902 WP_000235798.1.8891 WP_000235798.1.88957 WP_000235798.1.88980 WP_000235798.1.88981 WP_000235798.1.89008 WP_000235798.1.89114 WP_000235798.1.89116 WP_000235798.1.89119 WP_000235798.1.89138 WP_000235798.1.89304 WP_000235798.1.89512 WP_000235798.1.89570 WP_000235798.1.89604 WP_000235798.1.89622 WP_000235798.1.89657 WP_000235798.1.89765 WP_000235798.1.89817 WP_000235798.1.89902 WP_000235798.1.89940 WP_000235798.1.8996 WP_000235798.1.90252 WP_000235798.1.90453 WP_000235798.1.90458 WP_000235798.1.90472 WP_000235798.1.90557 WP_000235798.1.90641 WP_000235798.1.90734 WP_000235798.1.91003 WP_000235798.1.91056 WP_000235798.1.91179 WP_000235798.1.91278 WP_000235798.1.9131 WP_000235798.1.91512 WP_000235798.1.91524 WP_000235798.1.91564 WP_000235798.1.91621 WP_000235798.1.91628 WP_000235798.1.91655 WP_000235798.1.91724 WP_000235798.1.91732 WP_000235798.1.91788 WP_000235798.1.91903 WP_000235798.1.92013 WP_000235798.1.92060 WP_000235798.1.92093 WP_000235798.1.92108 WP_000235798.1.92165 WP_000235798.1.92171 WP_000235798.1.92183 WP_000235798.1.92268 WP_000235798.1.92299 WP_000235798.1.92310 WP_000235798.1.92318 WP_000235798.1.92443 WP_000235798.1.92482 WP_000235798.1.92529 WP_000235798.1.92531 WP_000235798.1.92671 WP_000235798.1.92738 WP_000235798.1.92893 WP_000235798.1.93059 WP_000235798.1.93086 WP_000235798.1.93101 WP_000235798.1.93136 WP_000235798.1.93155 WP_000235798.1.93213 WP_000235798.1.93275 WP_000235798.1.93339 WP_000235798.1.93365 WP_000235798.1.93376 WP_000235798.1.93543 WP_000235798.1.93650 WP_000235798.1.93656 WP_000235798.1.93662 WP_000235798.1.937 WP_000235798.1.93705 WP_000235798.1.93804 WP_000235798.1.9389 WP_000235798.1.93937 WP_000235798.1.93994 WP_000235798.1.94072 WP_000235798.1.94162 WP_000235798.1.94168 WP_000235798.1.94198 WP_000235798.1.9432 WP_000235798.1.94354 WP_000235798.1.94380 WP_000235798.1.94458 WP_000235798.1.94584 WP_000235798.1.94655 WP_000235798.1.94674 WP_000235798.1.94796 WP_000235798.1.94947 WP_000235798.1.94959 WP_000235798.1.94967 WP_000235798.1.95051 WP_000235798.1.95085 WP_000235798.1.95171 WP_000235798.1.95248 WP_000235798.1.95277 WP_000235798.1.95282 WP_000235798.1.95388 WP_000235798.1.95546 WP_000235798.1.95630 WP_000235798.1.95670 WP_000235798.1.95691 WP_000235798.1.95911 WP_000235798.1.95939 WP_000235798.1.96004 WP_000235798.1.96139 WP_000235798.1.96162 WP_000235798.1.96317 WP_000235798.1.96343 WP_000235798.1.9644 WP_000235798.1.96469 WP_000235798.1.96497 WP_000235798.1.96555 WP_000235798.1.96563 WP_000235798.1.96732 WP_000235798.1.9674 WP_000235798.1.96771 WP_000235798.1.96810 WP_000235798.1.96902 WP_000235798.1.97015 WP_000235798.1.97047 WP_000235798.1.97143 WP_000235798.1.97145 WP_000235798.1.97190 WP_000235798.1.97297 WP_000235798.1.97318 WP_000235798.1.97369 WP_000235798.1.97477 WP_000235798.1.97487 WP_000235798.1.97597 WP_000235798.1.97613 WP_000235798.1.97620 WP_000235798.1.97631 WP_000235798.1.97691 WP_000235798.1.97725 WP_000235798.1.97727 WP_000235798.1.97732 WP_000235798.1.97736 WP_000235798.1.9775 WP_000235798.1.97846 WP_000235798.1.9799 WP_000235798.1.98006 WP_000235798.1.98019 WP_000235798.1.98022 WP_000235798.1.98110 WP_000235798.1.98146 WP_000235798.1.98170 WP_000235798.1.98219 WP_000235798.1.98250 WP_000235798.1.9826 WP_000235798.1.9841 WP_000235798.1.98446 WP_000235798.1.98495 WP_000235798.1.98531 WP_000235798.1.98577 WP_000235798.1.98676 WP_000235798.1.98677 WP_000235798.1.98760 WP_000235798.1.98763 WP_000235798.1.98843 WP_000235798.1.9898 WP_000235798.1.99072 WP_000235798.1.99098 WP_000235798.1.99184 WP_000235798.1.99267 WP_000235798.1.99276 WP_000235798.1.99626 WP_000235798.1.99646 WP_000235798.1.99657 WP_000235798.1.99660 WP_000235798.1.99712 WP_000235798.1.99858 WP_000235798.1.99889 WP_000235798.1.99958 gi|194450498|ref|YP_002043988.1| gi|378987422|ref|YP_005250586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]