SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538363820|ref|YP_008507105.1| from Salmonella enterica serovar Bovismorbificans genomics

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538363820|ref|YP_008507105.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.27e-110
Family FMN-linked oxidoreductases 0.0000000000445
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.81e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|538363820|ref|YP_008507105.1|
Sequence length 672
Comment FAD/FMN-binding/pyridine nucleotide-disulphide oxidoreductase family protein [Salmonella enterica subsp. enterica serovar Bovismorbificans str. 3114]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAEGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRQEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0T7RZP6
WP_021000795.1.12280 WP_021000795.1.20119 WP_021000795.1.25036 WP_021000795.1.26856 WP_021000795.1.31251 WP_021000795.1.41440 WP_021000795.1.44607 WP_021000795.1.47067 WP_021000795.1.50374 WP_021000795.1.5523 WP_021000795.1.5555 WP_021000795.1.58442 WP_021000795.1.58836 WP_021000795.1.60794 WP_021000795.1.68591 WP_021000795.1.71368 WP_021000795.1.73669 WP_021000795.1.73956 WP_021000795.1.75884 WP_021000795.1.76024 WP_021000795.1.79642 WP_021000795.1.94967 WP_021000795.1.96902 WP_021000795.1.98446 gi|538363820|ref|YP_008507105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]