SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|CMU_020140 from Cryptosporidium muris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|CMU_020140
Domain Number 1 Region: 17-92,125-268,302-340
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.1e-17
Family Capz beta-1 subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|CMU_020140
Sequence length 344
Comment | organism=Cryptosporidium_muris | product=hypothetical protein, conserved | location=scf_25:94253-95384(+) | length=344
Sequence
MIQSNTHTHFNERIVRALRIWSKNLPTETEKCISNLCGLFPDISKELCERLETPLLMIYD
KEECKYFIGCTTNRIGNLYRSPYSGKFYYYEDSFDTNNDIVEQEDADLDSIRQSLEYIKN
DIQHLSLLESEYHQIYEQYCKYYCGYGIGLENDKSENGILLSNVYCYDIAGDSFGTTFTM
KHVTNPLNMLNLDSSEASSFNNLIYYLDIIHNVETVVSHVSGTAIYRLGSIYFFGFKKID
DSDPPTRDSMKLDACKTNWIEHKQDFNITNQNLMRTQTLGRATTMTNSLDNNSRNTITNN
TLLYHLKIIGKLIENTDNTMLKYIQNVLIDSLINIINNIHTVII
Download sequence
Identical sequences B6AJD3
XP_002142620.1.43237 gi|209558226|gb|EEA08271.1| gi|209882367|ref|XP_002142620.1| gb|CMU_020140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]