SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66043723|ref|YP_233564.1| from Pseudomonas syringae pv. syringae B728a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66043723|ref|YP_233564.1|
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.12e-36
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66043723|ref|YP_233564.1|
Sequence length 182
Comment cytochrome B561 [Pseudomonas syringae pv. syringae B728a]
Sequence
MQLRNSSSRYGLVSMVLHWGVAAVVFGMFALGLWMVGLDYYDTWRKAGPDLHKSIGITLF
AVMLIRVVWRLLSPPPPPLTSYSKLTRIGAAFGHLFLYVALFAVMFAGYLISTADGVGIP
IFGLFDVPALVSGLPDQAETAGWIHLYLAWVIVIFAGLHGLAALKHHFIDRDVTLKRMLG
RN
Download sequence
Identical sequences A0A0L8IN86 A0A0P9LY24 A0A120AKG3 A0A2G0VAK6 Q4ZZ96
205918.Psyr_0456 gi|66043723|ref|YP_233564.1| WP_011266415.1.11701 WP_011266415.1.19682 WP_011266415.1.34709 WP_011266415.1.36917 WP_011266415.1.41361 WP_011266415.1.45296 WP_011266415.1.48757 WP_011266415.1.49784 WP_011266415.1.53502 WP_011266415.1.58699 WP_011266415.1.7215 WP_011266415.1.72581 WP_011266415.1.73557 WP_011266415.1.81553 WP_011266415.1.81892 WP_011266415.1.83459 WP_011266415.1.86070 WP_011266415.1.92003 YP_233564.1.68675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]