SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66046508|ref|YP_236349.1| from Pseudomonas syringae pv. syringae B728a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66046508|ref|YP_236349.1|
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.8e-27
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66046508|ref|YP_236349.1|
Sequence length 179
Comment cytochrome B561 [Pseudomonas syringae pv. syringae B728a]
Sequence
MDVSTSQRYTARARWLHWVMAILIVLAYTLILSRTQFGKGSEYRLLVVQSHYWVGILILI
MAFFRVAERRRHRPPGITPPLEGALRIVATLTHYALYAFLLAQPLLGLLTVMVEKGALPI
PLTDLQIPWPLATSDHLAETFEDLHKLLGSIFYYVIGLHVIAALWHHLVRKDNTLKRML
Download sequence
Identical sequences A0A0P9ZQH4 A0A2G0VF62 A0A2G4EKV1 Q4ZRB1
205918.Psyr_3279 WP_011268328.1.11701 WP_011268328.1.19481 WP_011268328.1.19682 WP_011268328.1.34709 WP_011268328.1.48757 WP_011268328.1.49784 WP_011268328.1.53502 WP_011268328.1.58699 WP_011268328.1.7215 WP_011268328.1.72581 WP_011268328.1.81892 WP_011268328.1.83459 WP_011268328.1.92003 YP_236349.1.68675 gi|66046508|ref|YP_236349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]