SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66046601|ref|YP_236442.1| from Pseudomonas syringae pv. syringae B728a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66046601|ref|YP_236442.1|
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.1e-38
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66046601|ref|YP_236442.1|
Sequence length 206
Comment hypothetical protein Psyr_3372 [Pseudomonas syringae pv. syringae B728a]
Sequence
MKTRPIHPWPVRLTHWVNAVGMVCMFMSGWAIYNASPLMPFTFPKFLTLGGWLGGSIAWH
FAVMWLLVINGLIYVLYGVFSRHFKRDLLPVRPSEVTRDMNDALHFRLVHVKGRYNAVQR
LMYWLVLAMGVLVVLSGLAIWKPVQFQGLVSLLGGFDFARWVHFGAMTAIGAFVIVHLLL
VVLVPSTLLPMITGGRQPNEDGTAQS
Download sequence
Identical sequences A0A120AM29 A0A2G0VFD3 Q4ZR18
205918.Psyr_3372 gi|66046601|ref|YP_236442.1| WP_011268393.1.19481 WP_011268393.1.36917 WP_011268393.1.48757 WP_011268393.1.49784 WP_011268393.1.53502 WP_011268393.1.58699 WP_011268393.1.7215 WP_011268393.1.72581 WP_011268393.1.81892 WP_011268393.1.92003 YP_236442.1.68675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]