SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|TGGT1_020570 from Toxoplasma gondii GT1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGGT1_020570
Domain Number 1 Region: 91-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-26
Family Skp1 dimerisation domain-like 0.0000711
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily POZ domain 5.23e-19
Family BTB/POZ domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|TGGT1_020570
Sequence length 170
Comment | organism=Toxoplasma_gondii_GT1 | product=S-phase kinase-associated protein, putative | location=TGGT1_chrIb:229253-231105(-) | length=170
Sequence
MSKERMGDARKVTLVSQEGDEFDVDIEVASMSALIKTMVEEDSDCQESIPLPNVDTCILK
KIIEYCEHHHNNPPEEIPKPLKSSNLAEVVSEWDYQFINENSDQKILFALILAANYLNIK
PLLDLSVAKVATMIKAKTPEEIRRIFNIVNDFTPEEEAQVREENKWCEDA
Download sequence
Identical sequences A0A074ST02 A0A086JER2 A0A086JSM1 A0A086KXL8 A0A086LVJ2 A0A086PZG0 A0A086QSP3 A0A0F7UNE6 A0A125YIV4 A0A125YIV5 A0A139XRK3 A0A151HGH4 A0A2G8XTY4 B9PXF8
gi|211967236|gb|EEB02432.1| gi|237840549|ref|XP_002369572.1| gb|TGVEG_040610 gb|TGME49_007680 XP_002369572.1.89292 XP_008886921.1.28481 gb|TGGT1_020570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]