SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|29582|estExt_Genewise1.C_70281 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mucci1|29582|estExt_Genewise1.C_70281
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 6.28e-18
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|29582|estExt_Genewise1.C_70281
Sequence length 97
Sequence
MIVIDNVKYACQKCIKGHRSSRCDHTERHLVIVKRKGRPISQCDECREQRLKRHIHQKCV
CPKLSGKKKYLTNTTSNATKTLNTSRHIMSIEALLLS
Download sequence
Identical sequences A0A168HVC8
jgi|Mucci1|29582|estExt_Genewise1.C_70281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]