SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|75835|fgeneshMC_pm.13_#_68 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mucci1|75835|fgeneshMC_pm.13_#_68
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 4.32e-29
Family Cyanase C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000126
Family SinR domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|75835|fgeneshMC_pm.13_#_68
Sequence length 134
Sequence
MHSFEQIGQELGVDEVYAAAIFYGQAKPTEDQIKKLTALLNIPTQHLVEEMGEHYFPSRG
GLMSMPPEDPTLYRFVEMIKVYGYPLKAIIHEKFGDGIMSAIDFKAHVDKVEDPKGDRVK
ITLDGKFLPFNKGW
Download sequence
Identical sequences jgi|Mucci1|75835|fgeneshMC_pm.13_#_68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]