SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|29487|estExt_Genewise1.C_70031 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mucci1|29487|estExt_Genewise1.C_70031
Domain Number 1 Region: 38-297,396-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-79
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000323
Further Details:      
 
Domain Number 2 Region: 489-632
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.62e-47
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 274-392
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.24e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|29487|estExt_Genewise1.C_70031
Sequence length 632
Sequence
MVATAAARGFHSSKPAWQVMARHPLYAKEAKGLHVPGNYPIFDHEYDAVVVGAGGAGLRA
AFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIHYMCREAPHTVIELENYGVPFSRTPEGKIYQRAFGGQSLKFGKGGQAYRCAAVADRT
GHAILHTLYGQSLRHDTNYFIEYFALDLIMEDGECKGVIALNMEDGTLHRFRSHKTVLAT
GGYGRAYFSCTSAHTCTGDGNAMVARAGLPLQDPEFVQFHPTGVYGSGCLITEGSRGEGG
YLVNSAGERFMERYAPTAKDLASRDVVSRAMTLEIKAGRGVGAEKDHIHLQLHHLPPAVL
HERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRVSGEVITQDEEGNDKVVPGL
YAAGEAACVSVHGANRLGANSLLDIVVFGRAVAHHIADTLEPGTPLTPLAADAGAETIAN
MDKLRNSQGPKRTSEVRLHMQKVMQADAAVFRTQETLDQGRVKIDQVWDSFKDVGVTDRG
MIWNTDLVETLELQNLLTCASQTMHAAAVRTESRGAHARDDYQERDDKNWMKHTLTWQDQ
DNGQVTIKYRHVTDTTLDEKECKPVPPFARVY
Download sequence
Identical sequences A0A162YJS5
jgi|Mucci1|29487|estExt_Genewise1.C_70031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]