SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|88136|estExt_fgeneshMC_pm.C_30492 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mucci1|88136|estExt_fgeneshMC_pm.C_30492
Domain Number 1 Region: 6-365
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-108
Family IF2B-like 0.0000000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|88136|estExt_fgeneshMC_pm.C_30492
Sequence length 378
Sequence
MTDNNNTKTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAI
VAALSLAVDVHARFEQGEFDTVDQAVKFLLESLEYLKTSRPTAVNLFDAAAKLEHLINTT
SKTAQEPVTVVTAYIEAAEQMLIDDVKDNKNIGKFGADYIVENAKNPSNISVLTHCNTGS
LATAGWGTALGIIRDLHKNNKLEHAYCTETRPYNQGSRLTAYELVYEQIPATLICDNMAS
ALLKQNPNVQAIVVGADRVAANGDTANKIGTYQLAITAKHHGVLFIVAAPSTSIDLKTKS
GDDIPIEQRPAEELVTVAGVRVNDNEPTTVRTAAAEIGVWNPSFDVTPASLISAIVTEQG
VVVKKDGEDVFDMAAFLK
Download sequence
Identical sequences jgi|Mucci1|88136|estExt_fgeneshMC_pm.C_30492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]