SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mucci1|89230|estExt_fgeneshMC_pm.C_80029 from Mucor circinelloides

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mucci1|89230|estExt_fgeneshMC_pm.C_80029
Domain Number 1 Region: 25-53
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.00000000458
Family GAS2 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mucci1|89230|estExt_fgeneshMC_pm.C_80029
Sequence length 73
Sequence
MSSMGGKKMYTCKLMTYADRRGGQFKNNKVLIRVGGGWQDLEFFLLEHSSLMASDVVVRS
FGATGNTNHGWRN
Download sequence
Identical sequences S2JRR0
jgi|Mucci1|89230|estExt_fgeneshMC_pm.C_80029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]