SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for UM01973 from Ustilago maydis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  UM01973
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000375
Family SinR domain-like 0.04
Further Details:      
 
Domain Number 2 Region: 93-121
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 0.00000000693
Family Cyanase C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) UM01973
Sequence length 123
Comment | Ustilago maydis hypothetical protein (124 aa)
Sequence
MSSSNIQRPKILSTLPSIFSYLHDAKVRSKMTFADIAAEMDRDEWYVAAIFYGQAKPDQA
DIVKLSAALNLQQRYLDEAFGPDFFPHRGLGEFPPQDPVLYRLYEVLVVYGYPLKHMIHE
KAR
Download sequence
Identical sequences 5270.UM01973.1 UM01973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]