SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for UM02671 from Ustilago maydis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  UM02671
Domain Number 1 Region: 735-1166
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 6.41e-110
Family ArgJ-like 0.00000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) UM02671
Sequence length 1169
Comment | Ustilago maydis hypothetical protein (1170 aa)
Sequence
MILQPSSSKSKLTSHQDHHLVPHSISLRRLLSRLDKSELVSLVTRWLDNAGPSYIPPMLS
RRQPKAGQEDSVTNLTLYHAILDLNEERRCRSMDELRLLWTGPMSDPRVPKARALDRISD
VDWPEGLSYAMVAELDLFYAHARQLSKTWSTVKLEYDDDVDAAGRGWERLSETQIRLRLG
NELGHYFEHHIYLHPRVKPEDRNAAAVRSWTDSFSYFRIVLAPIPSDVCGTGLHILHLPR
TPFLLVSGSLGRGSENREMALSAFAAAAGATTVNYAKPAAGSAAAKKLLAELNDAGEDAA
GNRRTLGELRGKDPLALREILLHESGRLSSTSDASAAPAGVAGGGKARQMQFSQGGSGQG
AEDGPLIAPLKRRREEDLSLLGIRPPTPPASGSERDTVSLSSASTSARPTQRRSSLTPCS
QTPQETHQHAREALTTRMESQREANELFGPKPNPYDPSNDALPRVERIEYELHLPFPAMQ
RYNTRSLIDMDAYNSDPEKPKIKLRLEGTHVLAGLRKLVAAGMDRSTSRLDAGEGQGDDD
DEEDGQAEKYEGAVKPVKLDGLPGWLTEVRGTKVVVQPSPPGDDSSRDMLRLCRDAENTL
VTHDCGRVQRARCKAAVVSHKCQETRLLDRFARLNTLLTTTIYLHSSFAVREGTTRKRKM
ISSLLSRSSIARRAVRGFASTAVQLDASAKLNKPARFAQPISASDIPKGFVVSSTYAGIK
AAISPKPADPNTSASTAAASNPNPKPDLALIVSTVPAAAAGTFTRNVFKAAPVVVSNQVL
LDGAKKEQGARVQTVLVNSGCANAVTGTQGMQDAESCVELVKKHLAPHPGLAQSSEGRET
LLLSTGVIGVPLPMPTIKRCIPHLANGMILRSDPESWRETARAFMTTDTFPKLRAKTFKL
GGKEVRMIGIDKGAGMIHPAMTGPAVPSAVSSGQLHATMLGLIATDAAVQPKALQVALNR
AVSRSFNCISVDGDMSTNDTIILLANGQSAASSSTAVANEIDESSPDFEPFVSELTAFCQ
ELSKLIVRDGEGAEKFVEITCTNAPSYTVAHGLLSRLVTSMLFKCAIHGQDANWGRILAS
VGGADPSLTKDVDASKVSVSFVDPTGEFESITVLRDGNPVKVDEDEIGKLLTKEDIKVVI
DLQNGKEDCTYWTCDLSREYIEINADYRS
Download sequence
Identical sequences 5270.UM02671.1 UM02671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]