SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for UM00766 from Ustilago maydis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  UM00766
Domain Number 1 Region: 460-702
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000301
Family Tropomyosin 0.00062
Further Details:      
 
Domain Number 2 Region: 615-870
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000036
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 3 Region: 197-306
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000724
Family Myosin rod fragments 0.0045
Further Details:      
 
Weak hits

Sequence:  UM00766
Domain Number - Region: 1083-1328
Classification Level Classification E-value
Superfamily Tropomyosin 0.00392
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 1773-1882
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) UM00766
Sequence length 2328
Comment | Ustilago maydis hypothetical protein (2329 aa)
Sequence
MADAEAAERAAKAARARAKLKKHQAQKKAAAEAETGTAASTTTSKDDAGSPPSDHADTPM
LEESVSAIDDDATDKSASKVDKPEAVVSETAGHSAELQEAQTKIASLALQLESTNEDLKK
ATEEASSLKRQLDQHKEEAQASLQALEHSNKTATEMLENDLSKQRAKATQLEAELQSQRD
LLQTAQKQVAVSMKTVSDLEASHKKDADESKALKDRLALVEADHKKASDRSSELEISLSE
LQEASAKASSKAKGLAAKLKEAEGRIQDAEAKFESEAKSVKQLHEDKAKLEADMQEKQKQ
ADDLRKTLSSRETTIQDLEMKLSDPSKANQIEALHKQLAEAAAKISILQADVREKDQSIR
SSSADSEKLVQQVKELKQQAESSRSSITALEGKLAEATDREAKVNSSLKDMIAKNSTLAS
QHEELEKKHAKTEADVQIWTKKVEQHTQSLAKSEEAAASVKDRANSAEKQLAAVQKESDL
LDSSLSDVKQQVETLTRDKADLEKANADAFNTSEKTVQESAKEIMELKSKVRQLEEQALT
DSKAASQLLEDAKTQASKSAKDAKNLSASLKESQDKLKALETQLKERDSHLSSAKDKQTS
TEQDLAAATSQVEKVSNELEGVKAQLTCAKNEHAQSLNKIKDLNEQLTKAESDVKTLDTA
AAKAQAELEASKKRVVSFETKEKEWLSKHKELESAKSMVLEDMAALKKDVDNHKTGSANT
SKELAALSSKHDEVQKNLQQAQQKLQETSAKSSEREKQIVDLTSQLVSSKSETDKEREKI
ESLQAKLDAEREAHRQSEQAAMQIEAKLGTTTKRADDLDERVQSLSSELDKVKSDHKQAQ
STAADRQKELESAKLEASKVNDELNAVKLALTKSEEAFNKLEGDKSAMDKIVTSLREEKL
ASDKKLELLVADLEKARNDYRDAISQSEQHQATAETREKELSQIKRDVQVHEATIADLQG
KHTSLEKSSAQLTEVKEKLKKDLEAAILGAQNQKASAESKDKDIKALEAKLSTSEASLTK
ATDDAAAIRAHNDKLQRELEAQTKELDAFSKSAEQMAERIKALEAKVADDGIQLAKSSEE
VIASKAQMTQLENDVQTRTSELEASRAEAQASKSSAEALTKELSAVKAKLEESDVKLSQS
TEDVASAQARIQELHSQLEAKSSELNAKTSESDQYKAKVEQLVEQLETAQQQQSNLQDKL
KEAATAHVDLSKLHEQKTAEHEAAQAEIKEQRTLVTKKTKDHELARAEATKLSETLKALQ
STHEDVNQQWQDVEARHKALVAQHAEHSKVSQAQTKELEAAKAKIDDLSSELSASSAAYA
NVKTEMEEKTTLAQELEHKLQTSITEIEKLTERATAGEQSLIAKQEEFDTLQGQADEQAK
KLKALETELAAAQKSARDASLKHKAAVTAASKQVEALKAELEKAKTEHAQALASASDEHK
AALKVAAEELSSVRAELEQTKAAHSAALAAAAKELKSAIEAASKQLDDTKAEHTEAFAQA
LREHQVAAAAAENEFKALQSEHVAVQAEHAKLTAATSKELEQLNADVKKARAEHEKSKKE
HAESQSIASKRLAELEAEFSTAKQEHAEATEKAAEEHKASLTAASKRFEALTAEHVQVKS
QHAKAMQEALQQLEDVRAAHETAKSEHIGALESARQQVEELQAAYETAKAEHADALAQVD
KEHNSAFDSLAAERTKLGSELASLREEHEAAVSLHRTERDEASAKLTKATADHSAAQQAS
EQQLSALKASLEKLQRERDQQMAVHTTEMVDLSKGLEQAHAKIRDGEAELETRVKELDSV
REQLVSTEKDLKARSGELDSLRTEMERLKQALTSHDEKIESLHSNHASTLRDKARDLEAL
EKETERMKQELASRDEKIESLQSDHASALQDKDLALKALQNEMEQMKQELASRDARISSL
VSDHTFALAAKDEELSSVRNLHDSTTSERAHLSASLSETQSFLSTLQAELETVKAELSVA
KSTVDQNAQDKSSDASKLAKLLSEVTALKKKHLTAKSCAEAARKENVDLRTQLDKVRGEA
SKTGAESELLVEALRSELELVKAKAQEAEAKLVQVKSEHEAEVKKKADQDGLKREVDNES
VFSKEHLEDVIQVHELEKSTLRSMIRKLEASVFEETDKAHRAMRRAIELEERLRGVGSSS
NGAAGDGEAGSGRSHRRSTTSLHVPSLSPLVERETYDSQDVALPSPSPSNVSAASTTTST
ASARRGIRTLPASELPLPAAQRHRRRESLQMLAARIQPCSSLDSDASNSSLPPLQSVTIT
SKGHTPSNSINAPLAPTTDGRAKHAGRHQFANDELLYCACCRDDLIIV
Download sequence
Identical sequences A0A0D1CHB7
5270.UM00766.1 UM00766 XP_011386541.1.11705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]