SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for UM06318 from Ustilago maydis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  UM06318
Domain Number 1 Region: 194-537
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.7e-80
Family IF2B-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) UM06318
Sequence length 805
Comment | Ustilago maydis hypothetical protein (806 aa)
Sequence
MSDANPTSASRPSSAAGPSKAIADPASTKSQQAKQPAKEGATDKKSAKELKAARRAAKVA
ERAPSDGSEPQRAPSAVNAAQRGGAADRSQQHSRDGKRPGSSSANASGGNARLGTGAIGA
VGSNLVGNSGASASGAAAASMAALASSSGAKRGGHDNDLAAKLIPQHPSVALFGNVSSGK
SHKAHIAAQVSASFRSNIHPSILRLSSQLAQYKLMGADARAIALLRAMADVIRDYTTPRG
EMLNRDLLKSVSAQVGHLVDARAMGTSQGVAVRYLKYEISVVSADLTEDEAKEHLLERID
HFVRDRIVYASKIIRTQAGNKIKDGDVVMTFARSSVVEGTLLAAWQRGVRFQVIVVDTRP
LLEGKALLSVLLAAGIPCTYGLISSLSSLMPRADILLLGTSALLANGALYSRAGTATCAM
MAKQKGIPVIVCCETYKFSERVQLDSFVQNEAGNPQDLLLPSSEQAYDVTTDADHDGSEA
DNKRRGALIDVAEWQASPNLAVINLLYDVTPPRFISAVASEVGLSGPESVGVILRDYKSV
LYQGALTREFCLRVKPSLLVLCVLSIGAHVEDYVETRACPCCLSFAKTISLNDVGKESQC
QHDALRTVSRHFLERIHSHITSVMAVFEDFRNHAEGCNQSTINDKTQRTSHTSPNAALQV
LLDSIVHIPKYGFSKQAYLASYNSTLSAAETAKRLQTLQTLFPGPDCLFSSQLFIAWNRV
CDLSIIHELTHERVLHLIRNGHHFPAHPPPTISTQPPSESHLQDSLSKPSHLYQRFPPPK
LHSTLFHSEHAYLICGSQTLYHYSN
Download sequence
Identical sequences 5270.UM06318.1 UM06318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]