SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385245139|ref|YP_005813962.1| from Chlamydia trachomatis E/150

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385245139|ref|YP_005813962.1|
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily TrpR-like 3.14e-26
Family Trp repressor, TrpR 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385245139|ref|YP_005813962.1|
Sequence length 94
Comment Trp operon repressor [Chlamydia trachomatis E/150]
Sequence
MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQRE
IAEKYGVSIAQITRGSNALKGLDPQFKEFLQKEI
Download sequence
Identical sequences G4NNB5 O84171 Q3KMJ6 Q79RG8
gi|385240598|ref|YP_005808439.1| gi|385269832|ref|YP_005812992.1| gi|568111420|ref|YP_008921018.1| gi|385239677|ref|YP_005807519.1| gi|478461419|ref|YP_007736369.1| gi|389858734|ref|YP_006360975.1| gi|478474937|ref|YP_007724606.1| gi|15604888|ref|NP_219672.1| gi|478456905|ref|YP_007725498.1| gi|478456013|ref|YP_007726396.1| NP_219672.1.57406 WP_009871513.1.100466 WP_009871513.1.100644 WP_009871513.1.101362 WP_009871513.1.102133 WP_009871513.1.11717 WP_009871513.1.13674 WP_009871513.1.13837 WP_009871513.1.1409 WP_009871513.1.14786 WP_009871513.1.14984 WP_009871513.1.15381 WP_009871513.1.17422 WP_009871513.1.1923 WP_009871513.1.19304 WP_009871513.1.20022 WP_009871513.1.20093 WP_009871513.1.25246 WP_009871513.1.28239 WP_009871513.1.29171 WP_009871513.1.30792 WP_009871513.1.31128 WP_009871513.1.31373 WP_009871513.1.32156 WP_009871513.1.32856 WP_009871513.1.34934 WP_009871513.1.35043 WP_009871513.1.36518 WP_009871513.1.3661 WP_009871513.1.37417 WP_009871513.1.37673 WP_009871513.1.37956 WP_009871513.1.38504 WP_009871513.1.38813 WP_009871513.1.40272 WP_009871513.1.4187 WP_009871513.1.4264 WP_009871513.1.42889 WP_009871513.1.43504 WP_009871513.1.44223 WP_009871513.1.48551 WP_009871513.1.5036 WP_009871513.1.51530 WP_009871513.1.52091 WP_009871513.1.55117 WP_009871513.1.57520 WP_009871513.1.57533 WP_009871513.1.60937 WP_009871513.1.6151 WP_009871513.1.61683 WP_009871513.1.62968 WP_009871513.1.65182 WP_009871513.1.65391 WP_009871513.1.66489 WP_009871513.1.67250 WP_009871513.1.69355 WP_009871513.1.69519 WP_009871513.1.69991 WP_009871513.1.71619 WP_009871513.1.71686 WP_009871513.1.72034 WP_009871513.1.72164 WP_009871513.1.72442 WP_009871513.1.74323 WP_009871513.1.74635 WP_009871513.1.75470 WP_009871513.1.77153 WP_009871513.1.77651 WP_009871513.1.83525 WP_009871513.1.85256 WP_009871513.1.86066 WP_009871513.1.87298 WP_009871513.1.87666 WP_009871513.1.88177 WP_009871513.1.88937 WP_009871513.1.92427 WP_009871513.1.93216 WP_009871513.1.9343 WP_009871513.1.93600 WP_009871513.1.96955 WP_009871513.1.97602 gi|237804516|ref|YP_002888670.1| gi|478455097|ref|YP_007727287.1| 272561.CT169 315277.CTA_0182 580049.JALI_1631 672161.CTB_1631 gi|478460522|ref|YP_007735473.1| gi|478472227|ref|YP_007732794.1| gi|385245139|ref|YP_005813962.1| gi|385241531|ref|YP_005809371.1| gi|76788888|ref|YP_327974.1| gi|527322668|ref|YP_008348865.1| gi|478473130|ref|YP_007734578.1| gi|385269832|ref|YP_005812992.1| gi|385242453|ref|YP_005810292.1| gi|385246063|ref|YP_005814885.1| gi|237802594|ref|YP_002887788.1| gi|389859611|ref|YP_006361851.1| gi|478458716|ref|YP_007731900.1| gi|386262519|ref|YP_005815798.1| gi|478448788|ref|YP_007723711.1| gi|389857859|ref|YP_006360101.1| gi|478428299|ref|YP_007540739.1| gi|478474033|ref|YP_007730109.1| gi|478457816|ref|YP_007731001.1| gi|385243375|ref|YP_005811221.1| gi|471328338|ref|YP_007539863.1| gi|385244255|ref|YP_005812099.1| gi|478459619|ref|YP_007733687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]