SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385245418|ref|YP_005814241.1| from Chlamydia trachomatis E/150

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385245418|ref|YP_005814241.1|
Domain Number 1 Region: 8-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-102
Family G proteins 0.0000000624
Further Details:      
 
Domain Number 2 Region: 483-603
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-42
Family Translational machinery components 0.0000135
Further Details:      
 
Domain Number 3 Region: 269-405
Classification Level Classification E-value
Superfamily Translation proteins 4.01e-34
Family Elongation factors 0.0000575
Further Details:      
 
Domain Number 4 Region: 607-693
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.12e-26
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 5 Region: 409-485
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.04e-24
Family EF-G/eEF-2 domains III and V 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385245418|ref|YP_005814241.1|
Sequence length 694
Comment elongation factor G [Chlamydia trachomatis E/150]
Sequence
MSDQEFGLDAIRNIGIMAHIDAGKTTTTERILFYAGRTHKIGEVHEGGATMDWMEQEQER
GITITSAATTVFWLGAKINIIDTPGHVDFTIEVERSLRVLDGAVAVFDAVSGVEPQSETV
WRQANKYGVPRIAFVNKMDRMGANYFGAVESMREKLGANAIPVHCPIGSESQFVGMVDLI
SQKALYFLEETLGAKWEEREIPEYLQEQCATLRMQLLEELATVDESNEAFMEKVLENPDS
ITEEEIHTVMRKGVIEGKINPVLCGSAFKNKGVQQLLDVIVKWLPSPLDRGNVRGINLKT
GEEVSLKPSKDGPLAALAFKIMTDPYVGRITFIRIYSGTLKKGSAILNSTKDKKERISRL
LEMHANERTDRDEFTVGDIGACVGLKFSVTGDTLCDENQEIVLERIEAPEPVIDMAIEPK
SKGDREKLAQALSALSEEDPTFRVSTNEETGQTIISGMGELHLDILRDRMIREFRVEANV
GKPQVSYKETITKTSNSETKYVKQSGGRGQYAHVCLEIEPNEPGKGNEVVSKIVGGVIPK
EYIPAVIKGVEEGLNSGVLAGYGLVDVKVSIVFGSYHEVDSSEMAFKICGSMAVKEACRK
ALPVILEPIMKVTVITPEDHLGDVIGDLNRRRGKILGQESSRNMAQVSAEVPLSEMFGYM
TSLRSLTSGRATSTMEPAFFAKVPQKIQEEIVKK
Download sequence
Identical sequences A0A0E9C5C6
gi|527321057|ref|YP_008347256.1| WP_009872654.1.100466 WP_009872654.1.11717 WP_009872654.1.13766 WP_009872654.1.13837 WP_009872654.1.1409 WP_009872654.1.14786 WP_009872654.1.15381 WP_009872654.1.1923 WP_009872654.1.19304 WP_009872654.1.28239 WP_009872654.1.29171 WP_009872654.1.31373 WP_009872654.1.32156 WP_009872654.1.32856 WP_009872654.1.35043 WP_009872654.1.36244 WP_009872654.1.36518 WP_009872654.1.3661 WP_009872654.1.37417 WP_009872654.1.37673 WP_009872654.1.37956 WP_009872654.1.38813 WP_009872654.1.39258 WP_009872654.1.40272 WP_009872654.1.4187 WP_009872654.1.44223 WP_009872654.1.48551 WP_009872654.1.4939 WP_009872654.1.51530 WP_009872654.1.57520 WP_009872654.1.57533 WP_009872654.1.62510 WP_009872654.1.66489 WP_009872654.1.67104 WP_009872654.1.69519 WP_009872654.1.69991 WP_009872654.1.74635 WP_009872654.1.77153 WP_009872654.1.78375 WP_009872654.1.85256 WP_009872654.1.87298 WP_009872654.1.87666 WP_009872654.1.88177 WP_009872654.1.88937 WP_009872654.1.9107 WP_009872654.1.95142 WP_009872654.1.96955 gi|389858132|ref|YP_006360374.1| gi|478473408|ref|YP_007734856.1| gi|385241811|ref|YP_005809651.1| gi|478474311|ref|YP_007730387.1| gi|478472506|ref|YP_007733073.1| gi|385245418|ref|YP_005814241.1| gi|478461698|ref|YP_007736648.1| gi|386262793|ref|YP_005816072.1| gi|527319182|ref|YP_008345383.1| gi|478456291|ref|YP_007726674.1| gi|389859008|ref|YP_006361249.1| gi|527325044|ref|YP_008351238.1| gi|389859884|ref|YP_006362124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]