SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A009E9E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009E9E8
Domain Number 1 Region: 391-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A009E9E8
Sequence length 484
Comment (tr|A0A009E9E8|A0A009E9E8_ACIBA) Sulfate transporter family protein {ECO:0000313|EMBL:EXA59391.1} KW=Complete proteome OX=1310605 OS=Acinetobacter baumannii 348935. GN=J504_3295 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLSNVREQWFSNIRGDVLAGLVVGLALIPEAIAFSIIAGVDPKVGLYASFCIAVVISFVG
GRPAMISAATGAMALLMVTLVKEHGLEYLLAATILTGVIQILAGYLKLAKLMRFVSKSVV
IGFVNALAILIFMAQLPELINVTWHVYALVALGLAIIYLFPLVPKLGKLLPSPLVCIIAI
TLLAIALGIDVRTVGDMGSLPDTLPMFLIPNIPLNIETLMIILPYSVALAAVGLLESMMT
ATIVDEMTDTPSDKYQECKGQGIANIASGFMGGMAGCAMIGQSMINVKSGGLTRLSTFSA
GIFLLILVVFISDWLKVIPMAALVAVMIMVSISTFEWSSVTQLKDNPKSSNIVMIATVIV
VVATHNLALGVLTGVLLSALFLANKLENDIQVTASFEGTARLYDLRGQIFFSSSEKFMQG
FDFKEDVKDVIIDLTHSHIWDVTSVAMLDSVVNKFQKNGVNVTVRGLNEASSIMIDKYGT
HARI
Download sequence
Identical sequences A0A009E9E8 A0A1J6WZ75 D0T0L3 N9MV04
HMPREF0017_03087T0 WP_004282306.1.15330 WP_004282306.1.73828 WP_004282306.1.75017 WP_004282306.1.77517 WP_004282306.1.84984 WP_004282306.1.91890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]