SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009FLF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009FLF5
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily DsrEFH-like 9.03e-30
Family DsrEF-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A009FLF5
Sequence length 122
Comment (tr|A0A009FLF5|A0A009FLF5_ACIBA) DsrE/DsrF-like family protein {ECO:0000313|EMBL:EXA64037.1} KW=Complete proteome OX=1310605 OS=Acinetobacter baumannii 348935. GN=J504_2775 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSTLILVTSAPTSIYAWHALGLAQALQHKQEAFRVFFYQDGVSVANALQWVPDDQRHLTR
SWQDLNIRLPVCVSAALARGITDQENAQRHNIQQHNLADGFELVGLGELADAVQSSQRLI
QF
Download sequence
Identical sequences A0A009FLF5 N8WSJ0
WP_004785936.1.74971 WP_004785936.1.84984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]