SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A009HK03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009HK03
Domain Number 1 Region: 390-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000131
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009HK03
Sequence length 484
Comment (tr|A0A009HK03|A0A009HK03_9GAMM) Sulfate transporter family protein {ECO:0000313|EMBL:EXA98705.1} KW=Complete proteome OX=1310608 OS=Acinetobacter sp. 1295259. GN=J507_1968 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLSNVREQWFSNVRADILSGLVVGLALIPEAIAFSIIAGVDPKVGLYASFCIAVIISFVG
GRPAMISAATGAMALVMTTLVKEHGLQYLFAATVLTGVIQILAGYFKLAKLMRFVSKSVV
IGFVNALAILIFMAQLPELISVTWHVYLLVAIGLGIIYLFPYIPKIGKFFPSPLICIVIV
TLLAIFLGFDVRTVGDMGSLPDTLPIFLIPNIPFNLETLLIILPYSLALAAVGLLESMMT
ATIVDEMTDTSSDKFQECKGQGIANIASGFMGGMAGCAMIGQSMINVKSGGRTRLSTFCA
GIFLLILVVFLSDWLKVIPMAALVAVMIMVSISTFEWSSLTQFKNNPKSSNVVMIATVIV
VVATHNLALGVLTGVLLSALFLANKLENDIRIETSFEDQARLYELRGQIFFSSSEKFMQG
FNFKEKVKEVIIDLTHSHIWDVTSVAMLDSVVNKFQKNGIQVTVRGLNEASSIMIDKYGT
HAKI
Download sequence
Identical sequences A0A009HK03 A0A1C2UIP2
WP_017386008.1.102059 WP_017386008.1.1416 WP_017386008.1.18087 WP_017386008.1.20977 WP_017386008.1.26047 WP_017386008.1.31874 WP_017386008.1.35048 WP_017386008.1.35357 WP_017386008.1.37952 WP_017386008.1.53333 WP_017386008.1.54654 WP_017386008.1.59492 WP_017386008.1.59956 WP_017386008.1.65162 WP_017386008.1.671 WP_017386008.1.70450 WP_017386008.1.72045 WP_017386008.1.73014 WP_017386008.1.74328 WP_017386008.1.8428 WP_017386008.1.93542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]