SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A009JP65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009JP65
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009JP65
Sequence length 173
Comment (tr|A0A009JP65|A0A009JP65_ACIBA) STAS domain protein {ECO:0000313|EMBL:EXB24840.1} KW=Complete proteome OX=1310638 OS=Acinetobacter baumannii 1437282. GN=J537_3183 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MSTGHVEYASLNGTHIFKLIGEVRAHSCISLDKLLNRIEQQQNVVGAIVDLTETTFIDST
VLGILAKLGLKLKQVHQIQAVMLSTNPDITTLANSMGLGQVFVILNYCGDPSVCTLELTD
EHVTHSAMLNTVLDAHKTLMRLNENNQNMFEPLVKQLQKEQDCLNLDAHKQNA
Download sequence
Identical sequences A0A009JP65 A0A009L0H5 A0A022I520 A0A0B0KKQ7 N8V2J9 N9Q3U7
WP_004774748.1.24249 WP_004774748.1.32973 WP_004774748.1.35252 WP_004774748.1.35691 WP_004774748.1.37375 WP_004774748.1.38280 WP_004774748.1.53563 WP_004774748.1.55814 WP_004774748.1.86756 WP_004774748.1.88139 WP_004774748.1.9021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]