SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A009P9E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A009P9E6
Domain Number - Region: 52-97
Classification Level Classification E-value
Superfamily MIR domain 0.0654
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A009P9E6
Sequence length 163
Comment (tr|A0A009P9E6|A0A009P9E6_ACIBA) Spore Coat Protein U domain protein {ECO:0000313|EMBL:EXC04176.1} KW=Complete proteome OX=1310607 OS=Acinetobacter baumannii 625974. GN=J506_3935 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLTSITALAATSANIEVSAVIEKGCLFQESPKGLNFGTHASTSQENAITASITNSQDTWK
IECTSDVPVTITFGNGKSLNTSTQNRRLKHVSSENYIDYMLYRNANLTQPLGTSSANNTL
TLKSTEQNHLLSFQIYGLVDLSQGAINKMPGQYKDDVLITIAW
Download sequence
Identical sequences A0A009P9E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]