SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A009QNZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009QNZ9
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.84e-63
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009QNZ9
Sequence length 189
Comment (tr|A0A009QNZ9|A0A009QNZ9_9GAMM) N-acetylmuramoyl-L-alanine amidase family protein {ECO:0000313|EMBL:EXC27621.1} KW=Complete proteome OX=1310637 OS=Acinetobacter sp. 809848. GN=J536_2120 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKQITPYEVIDGQLKGARQIPSPNFNQRPTGTEIQMIVVHNISLPPSQFGGGYIEQFFQN
KLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWHAGRSSYLAKVECNDYSIG
IELEGSDDLPFEDVQYEVLTDVVTAIRQAYPEIKNHIAGHSDVAPGRKTDPGPYFKWQHF
RQLLAQKKT
Download sequence
Identical sequences A0A009QNZ9 A0A022J8Z2
WP_016802679.1.100086 WP_016802679.1.11037 WP_016802679.1.15843 WP_016802679.1.16785 WP_016802679.1.19727 WP_016802679.1.21163 WP_016802679.1.34068 WP_016802679.1.34178 WP_016802679.1.35862 WP_016802679.1.3591 WP_016802679.1.39054 WP_016802679.1.41195 WP_016802679.1.45253 WP_016802679.1.45892 WP_016802679.1.57061 WP_016802679.1.6133 WP_016802679.1.6540 WP_016802679.1.66414 WP_016802679.1.75893 WP_016802679.1.8016 WP_016802679.1.93557 WP_016802679.1.9696 WP_016802679.1.99031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]