SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010NDB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010NDB4
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.44e-31
Family N-acetylmuramoyl-L-alanine amidase-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A010NDB4
Sequence length 149
Comment (tr|A0A010NDB4|A0A010NDB4_9MICC) Negative regulator of beta-lactamase {ECO:0000313|EMBL:EXF24107.1} KW=Complete proteome; Reference proteome OX=652017 OS=Nesterenkonia sp. AN1. GN=BG28_07480 OC=Nesterenkonia.
Sequence
MTQNVIWKTSPNRTVGRGGVAVDRIVIHYIVGNLAACDATFLNPDSQVSAHYGIGEGRIH
QYVSVHNTAWHSGNFGFNQRSIGIEHSATPERPPTTQTLNMSIARCLTLCRQFNLNPLTA
IVPHDSVVPTACPGAVDWEYIRDRTAAQM
Download sequence
Identical sequences A0A010NDB4
WP_051501389.1.72444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]