SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010P6N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010P6N2
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily DsrEFH-like 4.71e-26
Family DsrEF-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A010P6N2
Sequence length 122
Comment (tr|A0A010P6N2|A0A010P6N2_9ALTE) Uncharacterized protein involved in the oxidation of intracellular sulfur {ECO:0000313|EMBL:EXF48994.1} KW=Complete proteome OX=1298865 OS=Alteromonas sp. ALT199. GN=H978DRAFT_1534 OC=Alteromonadaceae; Alteromonas.
Sequence
MAQLLIRFTQSPFSSAKSQDGLDFALAATNYGHDVKVLFENQGILQLVKAASTKGLKNHT
KRLASMPFFDIEECFVCKASADTYDIDQVLANNSLVDELDCKWITPEEKVALIQSVDHVV
TF
Download sequence
Identical sequences A0A010P6N2
WP_025255354.1.17455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]