SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010Q3S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010Q3S7
Domain Number 1 Region: 1-59,93-162
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.52e-29
Family Type II thymidine kinase 0.076
Further Details:      
 
Domain Number 2 Region: 163-212
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000323
Family Type II thymidine kinase zinc finger 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010Q3S7
Sequence length 216
Comment (tr|A0A010Q3S7|A0A010Q3S7_9MICC) Thymidine kinase {ECO:0000256|RuleBase:RU000544} KW=Complete proteome; Reference proteome OX=652017 OS=Nesterenkonia sp. AN1. GN=BG28_12585 OC=Nesterenkonia.
Sequence
MAKLYFRYGAMNSGKSTGLLQAAFNYEERGQRVLLAKPQVDTKGEDEIVSRLGVTRNVDF
LIPPQAPLRELVAQHAAGTTPGTLLDDMEAESGALNRQIKPVACLLVDEAQFLTPAQVED
LLRIAVLDDVPVLAYGIRTDFRTMAFPGSARLMDLAHALEELKTICRCGRKAVFNTRRAG
EAIIFDGDQVAIDGTDIWYESLCAACYLEASGGRLG
Download sequence
Identical sequences A0A010Q3S7
WP_036474556.1.72444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]