SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A010QKM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010QKM3
Domain Number 1 Region: 15-134,166-200
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 1.57e-36
Family Arp2/3 complex 16 kDa subunit ARPC5 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A010QKM3
Sequence length 200
Comment (tr|A0A010QKM3|A0A010QKM3_9PEZI) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_04289 OC=Colletotrichum.
Sequence
MSIHRELNAASLSDAWRTINIDALQEDSACNFDTSTLRPPQPEIGEDEVRQLAGQVRQLL
RGGDAEGALRGCLEFPVYNGPDGAKDAHLQTITEVLQSIKASEMTPLLKSIYGGPGGPEL
LDVLMKYIYKGMAGSAGSGGLRSPPPQAAPSGFSQMGGRPGATNENVGSAMSVLLSWHEK
VVDVAGLGTIGRVMTDWRRV
Download sequence
Identical sequences A0A010QKM3
XP_007595778.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]