SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A010QRH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010QRH8
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-82
Family Capz beta-1 subunit 0.0000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010QRH8
Sequence length 292
Comment (tr|A0A010QRH8|A0A010QRH8_9PEZI) F-actin capping protein {ECO:0000313|EMBL:EXF82732.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_12636 OC=Colletotrichum.
Sequence
MASVDPFDSALDLLRRLNPKHTTDHLNAIISLAPDLTEDLLSSVDQPLTVKRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLDEGGVGGVGAGGSEGAGEGAIPSERVRKMEVKANEA
FDVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSDRPLPPITAATPGGSAEGVWDSIHVF
EAIERGRTTQYKLTSTVILSLSTSTNALGDMDLSGNMTRQVEQELAVDGDESHIANVGRL
VEDMELKMRNLLQEVYFGKAKDVVGDLRSVGSLSEAGRDRAAQREIIGSMQK
Download sequence
Identical sequences A0A010QRH8
XP_007593616.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]