SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A010RV77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A010RV77
Domain Number 1 Region: 440-523
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000804
Family Anti-sigma factor antagonist SpoIIaa 0.029
Further Details:      
 
Weak hits

Sequence:  A0A010RV77
Domain Number - Region: 56-144
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0994
Family Bacterial photosystem II reaction centre, L and M subunits 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A010RV77
Sequence length 552
Comment (tr|A0A010RV77|A0A010RV77_PSEFL) Membrane protein {ECO:0000313|EMBL:EXF92824.1} KW=Complete proteome; Reference proteome OX=1042209 OS=Pseudomonas fluorescens HK44. GN=HK44_003685 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPTDPPTVSPQTTTERPNRLQDLLAGLSIAGLLLPEAVAYSSIAALAPQAGVIALFAGLL
CYGLFGTSRFAIVSATSSSAAVLAAATATLANGDPQLRASLAFGLVLVTGAFFLLAGLFK
LGSVTSFIAKPVLRGFAFGLALTIILKQLASVVGVHLHNGNPIHFLPELLEQLPQWNWAG
AGVAAVALALLWVFGRFRRLPGGLLVVVIGIAAGQWLNLPAYGVRMIGVIDLGLEIPKLP
VLPFADWLRLGELGFAMVMILYAESYGSISSFALKHGDRVSSNRDLLALGASNLLSGLFH
GMPAGAGYSATSANEAAGATSRFSGGVAALVVLIIVLTVLPYIALTPEPILAAIVMHALG
RGLSLQPLGRYFVWRRDRLLVICAVAAVLVLGVLDGLLVAVAISVLLMLKQMSAADIQVL
GHIGTGHDFVDVQRHPLAKAVPGMLIVRPGEALFFANAERILGGALHLIRHSETPIHTVI
LSLEESPDLDGTSIEALQEFFLRVRNEGKRLVLARLKLEAQAALSALPEVKRLQVTLCDL
SVDGAVQEALKA
Download sequence
Identical sequences A0A010RV77
WP_019690968.1.57360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]