SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A010RWI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A010RWI7
Domain Number - Region: 250-312
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0863
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A010RWI7
Sequence length 373
Comment (tr|A0A010RWI7|A0A010RWI7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:EXF84911.1} KW=Complete proteome; Reference proteome OX=1445577 OS=Colletotrichum fioriniae PJ7. GN=CFIO01_02124 OC=Colletotrichum.
Sequence
MDQDTETSIKSSVTTLLKSSITPFYAHCSQMDGSWRPTNQLSLLRCGEVAFDELEHLFLP
GEMVFTASATPTHDLNYEQCWIVESRVTSSKASLWDYKGPALWEKTEGALLDESVRESME
PRKWKHWNAMLEGRVVVDPDARQEKYLTATDVPPEVLKVTEEMSDQTYLICSGRVRAKCL
SDLRGVFVAIDELKPVEFQSVDPNTDNQMSASAEVASLVESFVPLIVQKSPMARPPLGKL
FVVRYELLDAAESLVETVAESIKRPCLRIDLLDFEDSDISSSAILQKIVDVLRLAVRLDA
LVCLRNFAPLLAKRSFKDRQNCRRILNFIRAIGAFPGTTFICLHEGDETDVEFDRLNPRE
LSVKLQKGVEEEG
Download sequence
Identical sequences A0A010RWI7
XP_007591351.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]