SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A011ABD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011ABD2
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.81e-27
Family Anti-sigma factor antagonist SpoIIaa 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011ABD2
Sequence length 122
Comment (tr|A0A011ABD2|A0A011ABD2_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=927661 OS=Cryptosporangium arvum DSM 44712. GN=CryarDRAFT_0339 OC=Cryptosporangium.
Sequence
MSLQVSVEHVDGVARCEIVGEVDMATTPQLRDELLGLVDAGHKYLVLDVSGVPFLDSTGL
GVLMEVHRRLRDNSGAAALVGARPALVRLLTITNLSRALPVYRSVEDASAAVTGSPAAEV
TG
Download sequence
Identical sequences A0A011ABD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]