SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A011LX77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011LX77
Domain Number 1 Region: 465-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000184
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A011LX77
Sequence length 581
Comment (tr|A0A011LX77|A0A011LX77_MANHA) Sulfate transporter {ECO:0000313|EMBL:EXI61823.1} KW=Complete proteome OX=1450449 OS=Mannheimia haemolytica serotype A1/A6 str. PKL10. GN=AK33_06760 OC=Pasteurellaceae; Mannheimia.
Sequence
MLNKWFLTKNTFLAVKPFSALKDAFQAGYTQKHLVRDIIAGLTVGVIAIPLSMALAIASG
VPPQHGLYTTIVAGFLIALTGGSRFNISGPTAAFVVILYPVTQQFGLSGLLMATLLSGII
LVLMALLRLGRLIEYIPLPVTLGFTCGIGIVIATLQIKDFLGLTVSEMPEHYIGKVNTLL
TALPTINWADTLVGIATFFILTHWHKLRLPIPGHLPAVIIGTLLSLLLISFGNHVATIGT
AFQYILPDGTLGYGIPSVLPEFTLPWNMPNPQGEKVNWNLTTLQALLPAAFSMAMLGAIE
SLLCAVVCDNMTNTKHHSNNELLAQGLGNIASPFLGGITATAAIARSAANVRSGAVSPIS
SMVHALLVLFALLFFAKALSYLPLSSMAALLLVVAWNMADIPQIIQLIRRSGKNEIAVLI
TCITLTVLFDMVIAITVGVLLASLLFIRTIAEMTKTIEMAAPQDLEDVLVYRISGPLFFA
AADNLFADLHEKTIHTDQEIKHIVLQCDAVTVLDAGGIHALTRFVQHMLPHQKLYMSNVQ
FQPMRMLVRSQKIVPEIQQIQFSSDLESVFEKIRQAELQQS
Download sequence
Identical sequences A0A011LX77
WP_042802947.1.20148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]