SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A011MUN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011MUN8
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A011MUN8
Sequence length 198
Comment (tr|A0A011MUN8|A0A011MUN8_9PROT) NADH-dependent phenylglyoxylate dehydrogenase subunit gamma {ECO:0000313|EMBL:EXI73928.1} KW=Complete proteome; Reference proteome OX=1454000 OS=Candidatus Accumulibacter sp. SK-11. GN=AW07_02066 OC=Candidatus Accumulibacter.
Sequence
MFQVRIHGRGGQGVVTAAEMLSIAAFEEGRHAQAFPSFGSERTGAPVVAFCRIADKEIRL
REPIMEPDALIIQDPTLLYQVDVFSGLKKNGYILINTSRSFDELGLGDYVRDWPKDHLCT
VPATDLSRKHVGRPMPNVPLLAGFAAASGIIRLESVIQAINAKFSDKVASSNIAAASEAY
QFVIDEIAHARHGETAHA
Download sequence
Identical sequences A0A011MUN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]