SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011N639 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011N639
Domain Number - Region: 22-80
Classification Level Classification E-value
Superfamily SH3-domain 0.0799
Family SH3-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A011N639
Sequence length 145
Comment (tr|A0A011N639|A0A011N639_9PROT) SH3 domain protein {ECO:0000313|EMBL:EXI78058.1} KW=Complete proteome OX=1454003 OS=Candidatus Accumulibacter sp. BA-92. GN=AW10_03326 OC=Candidatus Accumulibacter.
Sequence
MTRSLAVLLAAGLAVLPALAVEFRTVATATVLYDAPSPRGKKLFVIKRDTPVELVVLLEG
WAKVRDSEGGMAWLESKYLAMRHSVVVTAPRAQIRQSADESADLVFEAERNVALDYLEAA
ASGWVKVRHRDGASGYVRADQIWGL
Download sequence
Identical sequences A0A011N639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]