SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011P1G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011P1G9
Domain Number - Region: 54-111
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.0196
Family DNA repair protein MutS, domain II 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011P1G9
Sequence length 141
Comment (tr|A0A011P1G9|A0A011P1G9_9PROT) Uncharacterized protein {ECO:0000313|EMBL:EXI88833.1} KW=Complete proteome; Reference proteome OX=1454004 OS=Candidatus Accumulibacter sp. BA-93. GN=AW11_01936 OC=Candidatus Accumulibacter.
Sequence
MKRPAATTHKTAPIRKQRNILFAKFPPHQVPEASEFLGRIEQLEVERREQERAVGVAYDL
HQHSLEELEGSLEDNGYHLDNTLMSKMMRALIYYVEETQLHNLEAPQRPLKRSQSEAYTH
AWERHPHGDHDDTPPEWREYK
Download sequence
Identical sequences A0A011P1G9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]