SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011PK40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011PK40
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-35
Family Ribosomal protein S14 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A011PK40
Sequence length 101
Comment (tr|A0A011PK40|A0A011PK40_9PROT) 30S ribosomal protein S14 {ECO:0000256|HAMAP-Rule:MF_00537} KW=Complete proteome; Reference proteome OX=1454005 OS=Candidatus Accumulibacter sp. BA-94. GN=AW12_01976 OC=Candidatus Accumulibacter.
Sequence
MAKIAVINRGEKRRKVVKKYAGKRAELLAVITDQSLPIEDRFEARLKMQALPRNASPVRL
RNRCALTGRPRGVFRKFGLARGKLREFFMQGEVPGMVKASW
Download sequence
Identical sequences A0A011PK40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]