SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011PXH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A011PXH4
Domain Number - Region: 130-211
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0863
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011PXH4
Sequence length 285
Comment (tr|A0A011PXH4|A0A011PXH4_9PROT) Uncharacterized protein {ECO:0000313|EMBL:EXI92101.1} KW=Complete proteome; Reference proteome OX=1454005 OS=Candidatus Accumulibacter sp. BA-94. GN=AW12_00844 OC=Candidatus Accumulibacter.
Sequence
MTQGSKAGELVPIGVEALALQAADEQETTRTLERYGYFDTTLDQLVMQVRQRVQRSTEDM
LEIGRAVCCLRELPRGRYGAAIASIGLSADTARRLAGVAMKFLGHDRLRPLLELDQSKVY
ELALLDDADLEAMADDPARIDQVDRMSVSELRVALRSARHDGEAKDERLKDVHRENAALR
DEKVRNARYAPDMETYDSINRKAARQRAMHDSALQVISEMSEFGAVLNDVLEEADDAERE
HSLQTARWLAQQLAGLYLNHGIDVDFQEVVSPSWTRQPLATAGEE
Download sequence
Identical sequences A0A011PXH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]