SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A011Q5Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011Q5Y4
Domain Number 1 Region: 144-301
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000105
Family Phosphonoacetate hydrolase 0.059
Further Details:      
 
Weak hits

Sequence:  A0A011Q5Y4
Domain Number - Region: 381-475
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00135
Family Arylsulfatase 0.035
Further Details:      
 
Domain Number - Region: 675-712
Classification Level Classification E-value
Superfamily MIR domain 0.00235
Family MIR domain 0.0091
Further Details:      
 
Domain Number - Region: 640-671
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0301
Family E6 C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A011Q5Y4
Sequence length 851
Comment (tr|A0A011Q5Y4|A0A011Q5Y4_9PROT) Non-hemolytic phospholipase C {ECO:0000313|EMBL:EXI84565.1} KW=Complete proteome; Reference proteome OX=1454004 OS=Candidatus Accumulibacter sp. BA-93. GN=AW11_03804 OC=Candidatus Accumulibacter.
Sequence
MAMNEVEHVVLLMLENRSFDSMLGWLYENKKPLSNTPPLKPSESAYHGLQEITPSAYANE
DQTRNIKVLPTRGAEGLGVPNVNPGESFEHVTRQLFGTTKAGPGDKPTMRGYVRDYAELL
ASQGKDAAAVKRYAGQVMQSYTPAQLPVLNGLAEHYAVCDLWFSSVPSQTNTNRAFALCG
TSMGLVDNGFLEDATNLALKALEKVSGELIGDDRFRARTIFNALHDAGLTWSVVRQSGYL
PINFNMLAVAIEGVLLAAPGNLISRATVGMVMEYLRSLSSSEVSADYTYRLFPEIGKIPN
ANAHFSTLDSFLVSARQGRLPHFTYIEPEWTIAHQGTGNSAVSLSTYLFHQGNDYHPPGN
LDAGENLLKKIYSSLIANTEAWEKTLLIITFDEPVGTFDHVPPPPAIPPWGTGTPAFERQ
HDFNFDRYGARVPAILVSPRIAKGTVFRSPGSIPFDHTSIIATLLEWRGLSKAAEDFGQR
TANAPTFTNLVSLATPRTDASDLAFLKLARKRGEPVHFYDRFRLRNAQGQYVSRFLEHYV
VPFSKDDPAATEYFPTTSYETPVTFYCQNAAHRPDEGVILGTGSADTIKLISSEEGLGSY
NVLGNWKNSSDCYYFNDYMEGEYDRQQTWAISKLSPASGPLCFGDKVFLVNGGERLNSRY
NALYGHCYLCTDRDGSAWSVEPVVDGLPVEGALKYGDEVFLKHLKTNRYISAFKSQWGQW
KPTLGQANKVRLKLSLPDNAGYASTTQGFVADGACVALVSSREDLTSKGTRCDHLFSGSR
TDLYYYYADFAPRSSTWRLSTADGAPLRNGSTVYIVNDDTQQVIVPEGEFMTTRISAADD
ALWMIEGVPEK
Download sequence
Identical sequences A0A011Q5Y4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]