SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011U4P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011U4P1
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.75e-46
Family Ribosomal protein S13 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011U4P1
Sequence length 126
Comment (tr|A0A011U4P1|A0A011U4P1_9MICO) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome OX=1451261 OS=Microbacterium sp. MRS-1. GN=AS96_00985 OC=Microbacterium.
Sequence
MARLAGVDIPRDKRVVIALTYIYGIGRTRSVEILTATEIDESIRVKDLTDDQLVALRDHI
EGNYKVEGDLRREVAADIRRKVEIGSYEGLRHRRGLPVRGQRTKTNARTRKGPKRTVAGK
KKAGRK
Download sequence
Identical sequences A0A011U4P1 A0A150HE00 H8E4Z9 S3AI36
WP_005050491.1.11550 WP_005050491.1.23495 WP_005050491.1.38254 WP_005050491.1.73084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]