SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A011VI53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011VI53
Domain Number 1 Region: 27-182
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 9.81e-55
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000242
Further Details:      
 
Domain Number 2 Region: 198-260
Classification Level Classification E-value
Superfamily PGBD-like 8.63e-17
Family Peptidoglycan binding domain, PGBD 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A011VI53
Sequence length 268
Comment (tr|A0A011VI53|A0A011VI53_OCHAN) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:EXL08140.1} KW=Complete proteome OX=529 OS=Ochrobactrum anthropi. GN=BG46_00975 OC=Brucellaceae; Ochrobactrum.
Sequence
MSSVREIESELLQELALDRPDFAGATLDPSPNFGLRRDGKVPAFLILHYTGLATAEEAVQ
VLKSPDMEVSAHYLVHEDGQIVQMVSEKARAWHAGKSFWKGETDINSASIGIEIVNPGNL
EDYPPFKDAQIDAVIRLCRDICERYAIKPENVLAHSDIAPSRKTDPGHNFPWKRLHEAGI
GHYIQPTSIRGGRFLARGENGQPVEALQSMLALYGYEIAITGVFDEGTETVIKAFQRHFR
TQNVDGVADVSTIDTLYRLIFSLQNVTA
Download sequence
Identical sequences A0A011VI53
WP_029929047.1.102140 WP_029929047.1.12153 WP_029929047.1.87417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]