SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014CCW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014CCW3
Domain Number 1 Region: 113-367
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.98e-64
Family D-glucarate dehydratase-like 0.000000845
Further Details:      
 
Domain Number 2 Region: 4-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.4e-32
Family Enolase N-terminal domain-like 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014CCW3
Sequence length 368
Comment (tr|A0A014CCW3|A0A014CCW3_9GAMM) Muconate and chloromuconate cycloisomerases family protein {ECO:0000313|EMBL:EXT56040.1} KW=Complete proteome OX=1310907 OS=Acinetobacter sp. 25977_3. GN=J806_1616 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MYRTIETILVDIPTIRPHQLSVTTMRTQTLVLVKITTTDGIVGWGEATTIGGLNYGEESP
ESVKANIDTYFAPLLTSVKDLNVAQTLKLIRKNINGNRFAKCAVQTALLDIQAKRLGVPL
SEVLGGRLRNSLPVLWTLASGDTEKDIAEARKMIELKRHNTFKLKIGARPLQQDVDHVIA
IKKALGADVSVRVDVNRAWSELECIHGIQQLQDGGIDLIEQPCAIQNTEALARLTHRFDV
AIMADEALTGPDSAYRIAKNHGADVFAVKIEQSGGLIEACEVGKIAGLAGIDLYGGTMLE
GPVGSIASAHVFATFETLAFGTELFGPLLLTEEILKEPLRYENFELHLPTAPGLGIEIDE
DKIEKLRR
Download sequence
Identical sequences A0A014B0J3 A0A014C0X4 A0A014CCW3 A0A014DWM0 A0A014EIN2 A0A014EK32 A0A062NJ83
WP_025466176.1.100576 WP_025466176.1.16924 WP_025466176.1.17678 WP_025466176.1.21600 WP_025466176.1.29521 WP_025466176.1.31793 WP_025466176.1.370 WP_025466176.1.53546 WP_025466176.1.53558 WP_025466176.1.70478 WP_025466176.1.74078 WP_025466176.1.79917 WP_025466176.1.80429 WP_025466176.1.92445 WP_025466176.1.9755 WP_025466176.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]